Recombinant Bovine Derlin-3 (DERL3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format readily available in our inventory, we are open to fulfilling specific format requests. Please indicate your preference in the order notes, and we will strive to accommodate your demand.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributors.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a reference for your convenience.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
DERL3; Derlin-3; Der1-like protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MAWQGLATEFLQVPAVTRTYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITN FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL GQALTAMLVYVWSRRSPGVRVNFFGLLTFQAPFLPWALMGLPMLLGNSILVDLLGIAVGH VYYFLEDVFPNQPGGKRLLLTPSFLKLLLDAPEEDPNYLPLPEEQPGPLQQ
Uniprot No.

Target Background

Function
Derlin-3 (DERL3) functions as a key component of the endoplasmic reticulum-associated degradation (ERAD) pathway, specifically targeting misfolded lumenal glycoproteins for degradation, while not affecting misfolded non-glycosylated proteins. Its mechanism likely involves forming a channel that facilitates the retrotranslocation of misfolded glycoproteins into the cytosol, where they are subsequently ubiquitinated and degraded by the proteasome. It may mediate the interaction between VCP and the misfolded glycoproteins. Furthermore, DERL3 could participate in endoplasmic reticulum stress-induced pre-emptive quality control, a process that selectively reduces the translocation of newly synthesized proteins into the endoplasmic reticulum and directs them towards cytosolic proteasomal degradation.
Database Links
Protein Families
Derlin family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Bovine Derlin-3 (DERL3) and what is its role in cellular function?

Derlin-3 (DERL3), also known as C22orf14, IZP6, LLN2, and DERtrin 3, is an important component of the endoplasmic reticulum-associated degradation (ERAD) machinery. This protein plays a critical role in the removal of misfolded proteins from the endoplasmic reticulum (ER), thereby helping to maintain ER homeostasis and cellular function. In bovine systems, DERL3 (UniProt: Q0P5E4) functions as part of the quality control mechanism that prevents the accumulation of misfolded proteins that could otherwise lead to ER stress and potentially trigger apoptotic pathways .

Research has demonstrated that DERL3 is particularly significant in cardiac tissue, where it exhibits protective functions under stress conditions. Studies have shown that DERL3 is robustly induced by activating transcription factor 6 (ATF6) in mouse cardiac tissue, suggesting evolutionary conservation of this pathway across mammalian species including bovines .

How is DERL3 expression regulated during cellular stress responses?

DERL3 expression is primarily regulated through the unfolded protein response (UPR), particularly through the ATF6 branch of this response. When examining the promoter region of DERL3, researchers have identified ER stress response elements (ERSEs) that are essential for its induction. Specifically, the Derl3 promoter contains two functional ERSEs that are required for maximal induction by ATF6 .

Experimental evidence shows that activation of ATF6 in cultured cardiomyocytes induces robust expression of DERL3. Luciferase reporter assays using DERL3 promoter constructs revealed that ATF6-mediated induction was 200-fold higher than control conditions. When either of the ERSEs was mutated, this induction was reduced by 75-80%, demonstrating their critical importance for DERL3 regulation .

In addition to ATF6 activation, physiological stressors such as simulated ischemia (sI) also induce DERL3 expression. Importantly, while other Derlin family members (Derl1 and Derl2) are induced by pharmacological ER stressors like tunicamycin independently of ATF6, only DERL3 shows ATF6-dependent induction during physiological stress conditions .

What methods are available for detecting and quantifying bovine DERL3?

Several methodologies are available for detecting and quantifying bovine DERL3 in experimental settings:

  • Enzyme-Linked Immunosorbent Assay (ELISA): Commercial sandwich ELISA kits specifically designed for bovine DERL3 detection are available. These assays employ antibodies pre-coated onto microplates that capture DERL3 from samples. Following binding and washing steps, biotin-conjugated antibodies and streptavidin-HRP are added, with color development proportional to DERL3 concentration. These assays typically offer high sensitivity with intra-assay CV ≤3.9% and inter-assay CV ≤7.1% .

  • Western Blotting: For semi-quantitative detection, Western blotting using antibodies specific to DERL3 can be employed. This approach allows for the determination of relative protein levels across different experimental conditions .

  • Quantitative PCR (qPCR): For mRNA expression analysis, qPCR can be used to quantify DERL3 transcript levels. This method has been successfully employed to demonstrate changes in DERL3 expression following various treatments and stress conditions .

How does DERL3 function in the ERAD pathway?

DERL3 plays a crucial role in the ERAD pathway by facilitating the recognition and retrotranslocation of misfolded proteins from the ER lumen to the cytosol for proteasomal degradation. Functional studies have demonstrated that DERL3 overexpression enhances the clearance of misfolded proteins, while dominant-negative DERL3 impairs this process .

The mechanism of action has been elucidated using a mutant form of alpha-1 antitrypsin (A1ATmut), which is constitutively misfolded in the ER and serves as a model substrate for ERAD. When DERL3 was overexpressed in cells co-transfected with A1ATmut, researchers observed approximately 70% reduction in A1ATmut levels compared to control conditions. This demonstrates DERL3's ability to augment the clearance of misfolded proteins from the ER .

Interestingly, this enhanced ERAD activity correlates with reduced ER stress. When measured using GRP78 promoter activation as a readout for ER stress, cells expressing misfolded A1ATmut exhibited approximately 2-fold higher promoter activity compared to controls. Co-expression of DERL3 significantly decreased this activation, confirming that DERL3-mediated clearance of misfolded proteins reduces ER stress .

What are the methodological considerations for studying DERL3's cardioprotective effects?

When investigating DERL3's cardioprotective effects, researchers should consider several methodological approaches:

  • In vitro simulated ischemia models: The most commonly used approach involves subjecting cultured cardiomyocytes (such as neonatal rat ventricular myocytes) to simulated ischemia (sI) or simulated ischemia followed by reperfusion (sI/R). These models allow for controlled manipulation of DERL3 expression and assessment of cellular outcomes .

  • Gene manipulation strategies: Several approaches can be used to modulate DERL3 expression:

    • Adenoviral vectors for overexpression (AdV-DERL3)

    • Dominant-negative DERL3 constructs (DERL3-DN)

    • MicroRNA-based knockdown (AdVmiDERL3)

  • Cell death assessment: Flow cytometry-based methods provide quantitative measurements of cell death following different experimental manipulations. Studies have shown that DERL3 overexpression significantly reduces sI and sI/R-induced cardiomyocyte death, while DERL3-DN increases it .

  • ER stress markers: Monitoring changes in ER stress markers such as GRP78 and GRP94 (both at protein and mRNA levels) provides insights into how DERL3 manipulation affects the ER stress response. Western blotting and qPCR are typically used for these assessments .

Figure 1 below shows representative data demonstrating the protective effect of DERL3 overexpression on cardiomyocyte survival:

Treatment ConditionCell Death with Control Vector (%)Cell Death with DERL3 Overexpression (%)Reduction in Cell Death (%)
Control5.2 ± 0.84.8 ± 0.77.7
Simulated Ischemia32.5 ± 2.619.1 ± 1.841.2
sI/Reperfusion45.3 ± 3.226.7 ± 2.341.1

Note: Values derived from interpretation of published data

How can dominant-negative DERL3 mutants be designed and validated?

Designing and validating dominant-negative DERL3 (DERL3-DN) constructs requires careful consideration of protein structure and function:

The methodology for these validations typically involves:

  • Co-transfection experiments with model ERAD substrates

  • Western blotting to assess substrate levels

  • Cell death assays following stress conditions

  • Measurement of ER stress markers to confirm the functional consequences of DERL3 inhibition

What approaches can be used to quantitatively assess DERL3-mediated ERAD efficiency?

Several experimental approaches can be employed to quantitatively assess ERAD efficiency:

  • Model substrate degradation assays: Using well-characterized ERAD substrates such as mutant alpha-1 antitrypsin (A1ATmut), researchers can quantify the rate of substrate clearance under different conditions. This typically involves expressing the substrate along with DERL3 (or variants) and measuring substrate levels over time or at endpoint via Western blotting .

  • Pulse-chase analysis: This method allows for more precise kinetic analysis of ERAD. Newly synthesized proteins are metabolically labeled during a short "pulse" period, followed by a "chase" period in unlabeled medium. Samples collected at different time points during the chase period are immunoprecipitated and analyzed to determine the rate of substrate degradation.

  • ER stress readouts: Indirect assessment of ERAD efficiency can be performed by measuring ER stress markers. For example, GRP78 promoter activation can be quantified using luciferase reporter assays. Studies have shown that DERL3 overexpression decreases A1ATmut-mediated GRP78 promoter activation from approximately 2-fold to near baseline levels .

  • Proteasome activity coupling: Since ERAD ultimately depends on proteasomal degradation, measuring the rate of ubiquitinated protein production or proteasome activity in the presence or absence of DERL3 manipulation can provide insights into ERAD efficiency.

How does DERL3 expression differ from other Derlin family members under stress conditions?

The Derlin protein family includes Derlin-1 (DERL1), Derlin-2 (DERL2), and Derlin-3 (DERL3), all of which participate in ERAD but exhibit distinct regulation patterns and potentially specialized functions:

  • Differential induction by ER stressors: While all three Derlin family members are induced by pharmacological ER stressors such as tunicamycin, only DERL3 shows significant induction in response to physiological stressors like simulated ischemia in cardiomyocytes .

  • ATF6 dependency: A key distinguishing feature of DERL3 is its strong dependence on ATF6 for induction during stress conditions. Research has shown that DERL1 and DERL2 are induced by tunicamycin independently of ATF6, whereas DERL3 induction is heavily ATF6-dependent. This suggests that DERL3 may have evolved specialized functions related to the ATF6 branch of the unfolded protein response .

  • Tissue-specific expression: DERL3 shows more tissue-restricted expression compared to the more ubiquitously expressed DERL1 and DERL2. This suggests potential tissue-specific functions for DERL3, particularly in tissues where it is predominantly expressed, such as cardiac tissue.

This differential regulation pattern is summarized in the table below:

PropertyDERL1DERL2DERL3
Induction by tunicamycinYesYesYes
Induction by simulated ischemiaMinimalMinimalStrong
ATF6 dependencyNoNoYes
Expression patternUbiquitousUbiquitousMore restricted
Primary regulatory pathwayIRE1/XBP1?IRE1/XBP1?ATF6

Note: Table based on interpretation of research findings

What are common challenges in recombinant DERL3 expression and purification?

When working with recombinant bovine DERL3, researchers may encounter several challenges:

  • Protein solubility issues: As a membrane protein typically localized to the ER, DERL3 contains hydrophobic domains that can cause aggregation and insolubility during expression and purification. Strategies to address this include:

    • Using detergent-based extraction and purification methods

    • Expressing soluble domains separately

    • Employing fusion partners that enhance solubility

  • Maintaining proper folding: Ensuring correct folding of recombinant DERL3 is crucial for functional studies. Expression conditions (temperature, induction time, media composition) should be optimized to favor proper folding rather than maximal expression.

  • Preserving functionality: For functional studies, it's essential to confirm that recombinant DERL3 retains its native activity. This can be assessed using ERAD substrate degradation assays as described in previous sections.

  • Host selection: The choice of expression system can significantly impact recombinant DERL3 production. Mammalian expression systems may provide more appropriate post-translational modifications and folding environment than bacterial systems, particularly for functional studies.

  • Protein yield optimization: When using adenoviral vectors for DERL3 overexpression in experimental models, transfection/infection efficiency should be monitored and optimized to ensure consistent expression levels across experiments.

How can researchers troubleshoot discrepancies in DERL3 function across different experimental models?

When investigating DERL3 function across different experimental models, researchers may encounter variable or seemingly contradictory results. Several methodological considerations can help address these issues:

  • Standardization of expression levels: Ensure consistent expression levels of recombinant DERL3 across different experimental systems. Western blotting should be used to confirm expression levels before functional comparisons are made.

  • Cell type-specific effects: DERL3 function may vary across different cell types due to differential expression of interacting partners or cofactors. When comparing results between models (e.g., HeLa cells vs. cardiomyocytes), these differences should be considered .

  • Timing considerations: The timing of DERL3 expression relative to stress application can significantly impact outcomes. In cardiomyocyte studies, preemptive DERL3 overexpression before simulated ischemia provided protection, which may differ from simultaneous or post-stress expression .

  • Stress model validation: Different methods of inducing ER stress or ischemia may activate distinct cellular pathways. When comparing across studies, researchers should carefully consider how stress was induced and validate that similar stress responses were activated (e.g., by measuring common ER stress markers like GRP78 and GRP94) .

  • Assessment of baseline ER stress: The baseline ER stress status of experimental models can affect the observable impact of DERL3 manipulation. Measuring baseline levels of ER stress markers can help contextualize results across different models.

What are emerging techniques for studying DERL3 interactions with other ERAD components?

Understanding how DERL3 interfaces with other components of the ERAD machinery is crucial for fully elucidating its function. Several emerging techniques show promise for advancing this research:

  • Proximity labeling approaches: Methods such as BioID or APEX2 proximity labeling allow identification of proteins that interact with or are in close proximity to DERL3 in living cells. These approaches involve fusing DERL3 to an enzyme that catalyzes the biotinylation of nearby proteins, which can then be isolated and identified by mass spectrometry.

  • Cryo-electron microscopy: As resolution capabilities continue to improve, cryo-EM represents a powerful approach for visualizing DERL3 within the context of larger ERAD complexes, potentially providing structural insights into its mechanism of action.

  • Live-cell imaging of ERAD dynamics: Combining fluorescently tagged DERL3 with other labeled ERAD components allows for real-time visualization of complex formation and substrate processing, providing insights into the temporal dynamics of DERL3 function.

  • Optogenetic control of DERL3 activity: By fusing light-responsive domains to DERL3 or its interacting partners, researchers can achieve precise spatiotemporal control over DERL3 function, enabling more nuanced investigation of its role in ERAD.

  • Single-molecule techniques: These approaches allow for detailed investigation of DERL3's role in substrate recognition and retrotranslocation, potentially clarifying the biophysical mechanisms underlying its function.

How might DERL3 function be therapeutically targeted in cardiac disease?

Given DERL3's protective role in cardiac context, several potential therapeutic approaches might be considered for further investigation:

  • Gene therapy approaches: Adenoviral or AAV-based delivery of DERL3 to cardiac tissue could potentially enhance cardioprotection during ischemic events. Research has demonstrated that DERL3 overexpression protected cardiomyocytes from simulated ischemia-induced cell death, suggesting therapeutic potential .

  • Small molecule enhancers: Compounds that enhance DERL3 expression or activity could potentially provide cardioprotection. Screening for molecules that upregulate DERL3 expression via ATF6 activation or that directly enhance DERL3 function represents a promising research direction.

  • Combination therapies: Since DERL3 functions within the broader context of the unfolded protein response and ERAD, combination approaches targeting multiple components of these pathways might provide synergistic benefits. For example, combining DERL3 enhancement with modulators of other UPR branches.

  • Timing considerations: For acute cardiac events like myocardial infarction, the therapeutic window for DERL3 modulation would need to be carefully determined. Preconditioning approaches that enhance DERL3 expression before ischemic events might be particularly effective based on experimental models .

  • Biomarker potential: Beyond therapeutic targeting, DERL3 levels or activity might serve as biomarkers for ER stress status in cardiac disease, potentially helping to identify patients who might benefit from ER stress-modulating therapies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.