Recombinant Bovine Diacylglycerol O-acyltransferase 1 (DGAT1)

Shipped with Ice Packs
In Stock

Description

DGAT1 Gene and its Function

The DGAT1 gene is a candidate gene for milk fat synthesis . Research has been undertaken to determine the gene structure in dairy cows and buffalo to increase knowledge of the cause of milk fat variation .

DGAT1 Inhibition

Partial DGAT1 deficiency in mice suppressed postprandial triglyceridemia and led to elevations in glucagon-like peptide-1 (GLP-1) and peptide YY (PYY) only following meals with very high lipid content, and did not protect from diet-induced obesity . Maximal DGAT1 inhibition led to enhanced GLP-1 and PYY secretion following meals with physiologically relevant lipid content .

DGAT1 and Metabolic Disorders

DGAT1 is a triglyceride biosynthetic enzyme with a possible role in metabolic disorders .

T-863, a DGAT1 inhibitor, decreased body weight, improved insulin sensitivity, and alleviated hepatic steatosis in diet-induced obese mice .

DGAT1 and Milk Fat Synthesis

A novel single nucleotide substitution in an exonic splicing enhancer of the DGAT1 gene induces exon 16 skipping and results in enzymatically inactive diacylglycerol O-acyltransferase 1 . The mutation also reveals a link between triglyceride synthesis capacity and milk fat saturation and provides an important clue to the role of DGAT1 in milk fat saturation .

DGAT1 Alleles

By using a baculovirus expression system, both DGAT1 alleles have been expressed in Sf9 cells, and it has been shown that the K allele, causing an increase in milk fat percentage in the live animal, is characterized by a higher Vmax in producing triglycerides than the A allele .

DGAT1 in Hepatic Fatty Acid Metabolism

Data suggests that DGAT1 is particularly relevant in the context of hepatocyte triacylglycerol (TAG) synthesis from exogenous fatty acids . Disruption of both DGAT1 and DGAT2 altered lipid homeostasis, channeling fatty acids toward oxidation and generation of reactive oxygen species . Both DGAT isoforms play a role in promoting fatty acid storage into TAG and lipid droplets to protect hepatocytes from oxidative damage .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DGAT1; Diacylglycerol O-acyltransferase 1; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-489
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DGAT1
Target Protein Sequence
MGDRGGAGGSRRRRTGSRPSIQGGSGPAAAEEEVRDVGAGGDAPVRDTDKDGDVDVGSGH WDLRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPIQVVSL FLKDPYSWPALCLVIVANIFAVAAFQVEKRLAVGALTEQAGLLLHGVNLATILCFPAAVA FLLESITPVGSVLALMVYTILFLKLFSYRDVNLWCRERRAGAKAKAALAGKKANGGAAQR TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRLLEMLFLTQLQVGLIQQW MVPAIQNSMKPFKDMDYSRIVERLLKLAVPNHLIWLIFFYWLFHSCLNAVAELMQFGDRE FYRDWWNSESITYFWQNWNIPVHKWCIRHFYKPMLRRGSSKWAARTAVFLASAFFHEYLV SIPLRMFRLWAFTGMMAQIPLAWIVGRFFRGNYGNAAVWLSLIIGQPVAVLMYVHDYYVL NREAPAAGT
Uniprot No.

Target Background

Function
Diacylglycerol O-acyltransferase 1 (DGAT1) catalyzes the final and irreversible step in triacylglycerol synthesis, utilizing diacylglycerol and fatty acyl-CoA as substrates. It is highly expressed in small intestinal epithelial cells, playing a crucial role in dietary fat absorption. In the liver, DGAT1 esterifies exogenous fatty acids to glycerol, essential for fat storage synthesis. It is also present in mammary glands, contributing to milk fat production. DGAT1 may participate in very-low-density lipoprotein (VLDL) assembly. Unlike DGAT2, it is not essential for survival. DGAT1 functions as the primary acyl-CoA retinol acyltransferase (ARAT) in the skin, maintaining retinoid homeostasis and preventing retinoid toxicity that can cause skin and hair disorders. It exhibits additional acyltransferase activities, including acyl-CoA:monoacylglycerol acyltransferase (MGAT) and wax monoester and diester synthase activities. It can also utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor, synthesizing monoalkyl-monoacylglycerol (MAMAG).
Gene References Into Functions
  1. Investigation of the effects of dietary linseed oil, DGAT1, and their interaction on methane and hydrogen emissions, energy and nitrogen metabolism, lactation performance, ruminal fermentation, and rumen bacterial and archaeal composition in dairy cows. PMID: 28918153
  2. Evaluation of the association between DGAT1 K232A, SCD1 A293V, and LEPR T945M markers and milk fat composition in southern Chile. The study identified associations between the DGAT1 GC/GC allele and lower milk fat and protein content, reduced saturated fatty acid levels, and elevated polyunsaturated fatty acids. PMID: 27173340
  3. Analysis demonstrating the major effects of the DGAT1 K232A polymorphism on the fatty acid and mineral composition of bovine milk, highlighting its relevance to cow and human health, and the functional properties of milk fat and protein. PMID: 26898284
  4. Study of a novel mutation in DGAT1 potentially responsible for unsaturated milk fat in cattle. PMID: 25719731
  5. Identification of an effect of DGAT1 on subcutaneous fat thickness. PMID: 25414103
  6. Characterization of Russian and Kazakh populations of Kazakh white-headed cattle, revealing a high frequency of the AA genotype of RORC and DGAT1. PMID: 25975152
  7. Investigation of the DGAT1 p.Lys232Ala polymorphism in Romanian Holstein cattle and Romanian buffalo breeds, and its potential influence on fat percentage and fatty acid profiles. PMID: 25380462
  8. Association of novel SNPs and INDEL polymorphisms in DGAT1 with milk production and protein and fat milk composition. PMID: 24676595
  9. Significant effect of single nucleotide polymorphisms in the DGAT1 gene on fat distribution in Chinese commercial cattle. PMID: 23143182
  10. Analysis of the effects of the K232A polymorphism on milk fat composition in winter and summer. PMID: 23127906
  11. Demonstration that knockdown of DGAT1 expression significantly reduced triglyceride content in bovine mammary epithelial cells. PMID: 23539897
  12. Exploration of the use of leptin, leptin receptor, and DGAT1 polymorphisms as markers in genetic selection programs to improve milk composition parameters. PMID: 22127264
  13. Study of the pleiotropic effects of the Ala to Lys amino acid substitution at position 232 in mammary gland tissue. PMID: 22916903
  14. Report on the impact of different DGAT1 and leptin alleles on milk production in Giorlando cattle. PMID: 21396671
  15. Analysis indicating that the KK genotype has the greatest effect on milk composition traits, while the AA genotype has the greatest effect on yield traits, suggesting the potential use of DGAT1 as a gene marker for assisted selection. PMID: 21881942
  16. Observation of no differential allelic expression for the DGAT1 genes in bovine fetal tissues. PMID: 21899958
  17. Investigation of the interaction effects between the DGAT1 K232A mutation and polygenic terms on milk production traits in German Holstein dairy cattle. PMID: 21338826
  18. Proposal that the K232A substitution of the DGAT1 gene could serve as a standard for comparing effects on milk productivity. PMID: 21446190
  19. Results suggesting a lack of association between specific SNPs and intramuscular fat levels in a crossbred population. PMID: 20416823
  20. Analysis demonstrating an association between the DGAT1 allele encoding lysine at position 232 and increased 305-day milk fat yield in Holstein cows. PMID: 19781040
  21. Report on the effects of an amino acid substitution in DGAT1 on milk yield in Holstein cattle and its frequency in North American cattle. PMID: 20379885
  22. Study confirming the strong association between DGAT1 polymorphism and milk fatty acid composition, highlighting DGAT1's key role in mammary gland lipid metabolism. PMID: 20105547
  23. Suggestion of a potential effect of the DGAT1 polymorphism on nonreturn rates for insemination. PMID: 19841232
  24. Characterization of the K allele, showing higher Vmax in triglyceride production compared to the A allele. PMID: 14983021
  25. Examination and characterization of the K232A substitution in the DGAT1 gene in Bos taurus and Bos indicus. PMID: 15190946
  26. Hypothesis that variation in the number of tandem repeats of the 18mer element might affect the transcription level of the DGAT1 gene. PMID: 15342525
  27. Identification of DGAT1 as having the greatest additive effect on subcutaneous fat thickness in beef cattle following Bayesian model selection analysis of 5 candidate genes. PMID: 16175458
  28. Association of a specific allele with increased fat yield, fat and protein percentage, and decreased milk yield in Bos indicus and Bubalus bubalis. PMID: 17087837
  29. Simultaneous analysis of the influence of CYP11B1 and DGAT1 on multiple variables in a German Holstein pedigree. PMID: 17179535
  30. Characterization of both the VNTR and the K232A polymorphisms in the DGAT1 gene in three major French dairy cattle breeds. PMID: 17517739
  31. Detection of a SNP (C/T) at position 11785 in exon 17, resulting in an Ala to Val substitution at position 484 in buffalo DGAT1 protein. PMID: 17592768
  32. Identification of differences in the magnitude of effects between paternally and maternally inherited DGAT1 promoter VNTR-K232A haplotypes, indicating parent-of-origin effects on milk production traits. PMID: 17892573
  33. Clear influence of the K232A polymorphism on milk-fat composition. PMID: 17894561
  34. Observed effects of the bovine DGAT1 K232A polymorphism on fat and protein percentages and milk yield. PMID: 18420644
  35. Conclusion that selective breeding can increase unsaturation indices by capitalizing on genotypic information of SCD1 and DGAT1 polymorphisms. PMID: 18420645
  36. Significant effect of single nucleotide polymorphisms in Diacylglycerol acyltransferase on milk yield. PMID: 18650297
  37. Observation that DGAT1 and growth hormone receptor alleles associated with increased milk production had an adverse effect on reproduction, while the leptin allele associated with increased milk production was linked to marginally increased metritis frequency. PMID: 18822099
Database Links
Protein Families
Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of bovine DGAT1?

Bovine DGAT1 is an integral membrane protein consisting of approximately 498 amino acid residues encoded by a gene spanning 8.6 kb with 17 exons. The protein exhibits significant hydrophobicity, with more than 40% of its residues being hydrophobic, consistent with its function as a membrane-bound enzyme. Structurally, DGAT1 contains between 8-10 transmembrane domains based on in silico topology analysis, with the active site positioned to access substrates from both the cytosolic and luminal sides of the endoplasmic reticulum (ER) membrane. The protein has three main functional regions: an N-terminal hydrophilic domain (approximately 113 amino acids) involved primarily in regulation, a central region containing multiple transmembrane segments, and a C-terminal region that contributes to the catalytic site.

What are the key conserved motifs in bovine DGAT1 and how do they influence enzymatic activity?

Bovine DGAT1 contains several highly conserved sequence motifs critical for its function. The most notable is the FYxDWWN motif, which plays a pivotal role in acyl-CoA binding. This motif is located within a large luminal extra-membranous loop and significantly contributes to substrate recognition and binding. Additionally, DGAT1 contains a motif commonly found in protein kinases with diacylglycerol binding domains, supporting its evolutionary adaptation for lipid metabolism. Comparative sequence analysis across DGAT1 proteins from 70 different organisms revealed 41 completely conserved amino acid residues, indicating functionally critical regions. These conserved motifs influence enzymatic activity by determining substrate specificity, binding affinity, and catalytic efficiency.

How does DGAT1 catalyze triacylglyceride synthesis at the molecular level?

DGAT1 catalyzes the final step in triacylglycerol synthesis by transferring an acyl group from acyl-CoA to diacylglycerol (DAG). The reaction occurs within a hollow chamber formed by the MBOAT fold in the ER membrane, which shields the acyl transfer reaction from the hydrophobic core of the membrane . The structure shows a tunnel-shaped entrance from the cytosolic side that recognizes the hydrophilic Coenzyme A motif of acyl-CoA. A slit between transmembrane helices 7 and 8 likely allows entry of the acyl chain into the chamber, where it is accommodated by a hydrophobic pocket .

The reaction mechanism involves the positioning of the activated thioester of acyl-CoA in the vicinity of the catalytic histidine residue (His415 in human DGAT1), poised for nucleophilic attack from the hydroxyl group of DAG . When DAG approaches the catalytic center, its two hydrophobic aliphatic acyl chains likely remain partially outside the protein and are accommodated in the hydrophobic core of the membrane . This spatial arrangement facilitates the acyl transfer while maintaining the membrane association of both substrates.

What expression systems are most effective for producing recombinant bovine DGAT1?

For recombinant bovine DGAT1 production, researchers should consider several expression systems based on experimental objectives:

  • Bacterial systems (E. coli): While cost-effective and simple, these systems often result in inclusion bodies requiring refolding due to DGAT1's multiple transmembrane domains. They are suitable for producing protein fragments for antibody generation but less ideal for functional studies.

  • Yeast systems (P. pastoris, S. cerevisiae): These provide a eukaryotic environment with proper post-translational modifications while handling membrane proteins effectively. The split ubiquitin yeast two-hybrid technique has been successfully adapted for studying protein-protein interactions between membrane-bound enzymes like DGAT1 .

  • Insect cell systems (Sf9, Hi5): These offer advantages for functional studies of membrane proteins like DGAT1, with proper folding and post-translational modifications. The baculovirus expression system allows for high-level expression of functional DGAT1.

  • Mammalian systems (HEK293, CHO): These provide the most native-like environment for bovine DGAT1 expression, with proper folding, post-translational modifications, and membrane insertion. They are ideal for functional and structural studies but are more expensive and time-consuming.

The choice of expression tag (e.g., His, GST, MBP) affects purification efficiency and potentially enzyme activity. N-terminal tags are preferable since the C-terminus may be involved in catalytic activity.

What are the established methods for measuring DGAT1 enzymatic activity?

Several methodological approaches can be employed to measure DGAT1 activity:

  • Radioisotope-based assays: This traditional approach uses [14C]-labeled substrates (typically [14C]oleoyl-CoA) to track the formation of labeled triacylglycerol. The method provides high sensitivity but requires specialized facilities for radioactive materials .

  • In vitro reconstitution assays: For human DGAT1, researchers have established in vitro functional assays to measure activity by monitoring the conversion of substrates to products. Kinetic parameters can be determined by fitting the initial reaction rates at different substrate concentrations to the Michaelis-Menten equation .

  • Fluorescence-based assays: These utilize fluorescently labeled substrates or products, offering good sensitivity without radioactivity. Examples include NBD-labeled substrates or coupling reactions to fluorescence-generating systems.

  • Mass spectrometry-based methods: LC-MS/MS provides comprehensive analysis of DGAT1 products, allowing identification of specific molecular species of triacylglycerols formed. This approach offers detailed insights into substrate selectivity.

  • Coupled enzymatic assays: These systems measure CoA release during the DGAT1 reaction by coupling it to other enzymatic reactions that produce detectable signals, such as changes in absorbance or fluorescence.

For reliable results, researchers should carefully consider substrate presentation (detergent micelles vs. liposomes), buffer composition, and enzyme source (purified protein vs. membrane fractions or whole cells).

What approaches are used to study DGAT1 structure-function relationships?

Understanding DGAT1 structure-function relationships requires multiple complementary approaches:

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly in the FYxDWWN motif and other conserved regions, followed by activity assays helps identify catalytically important residues.

  • Chimeric proteins: Creating chimeras between DGAT1 from different species or between DGAT1 and related enzymes can identify domains responsible for specific functions or substrate preferences.

  • Truncation analysis: Generating truncated versions of DGAT1 helps delineate functional domains. For example, studies have shown that the N-terminal hydrophilic domain (approximately 113 amino acids) functions primarily in regulation rather than catalysis.

  • Cryo-electron microscopy: This has been successfully employed to determine the structure of human DGAT1 in complex with oleoyl-CoA, revealing the detailed architecture of the enzyme and substrate binding sites .

  • Computational approaches: Molecular modeling, docking, and molecular dynamics simulations can provide insights into substrate binding, catalytic mechanisms, and conformational changes during the catalytic cycle.

These methods collectively contribute to our understanding of how DGAT1's structure enables its enzymatic function and how variations in structure may affect activity.

How does DGAT1 contribute to bovine fatty liver disease pathophysiology?

DGAT1 plays a significant role in the development and progression of fatty liver disease in dairy cows, particularly during the postpartum period. After calving, dairy cows experience increased lipolysis, resulting in high concentrations of fatty acids in the bloodstream and hepatocytes . As a key enzyme in triacylglycerol synthesis, DGAT1 directly influences hepatic lipid accumulation through several mechanisms:

In experimental settings, isolated primary bovine hepatocytes challenged with high fatty acid concentrations demonstrate altered DGAT1 expression and activity . Understanding these changes is crucial for developing strategies to prevent or treat bovine fatty liver disease.

How do DGAT1 genetic polymorphisms affect milk production traits in dairy cattle?

Genetic polymorphisms in bovine DGAT1 significantly influence milk production traits, making them important markers in dairy cattle breeding programs. The most studied polymorphism is the K232A substitution (lysine to alanine at position 232), which has substantial effects on milk composition:

DGAT1 GenotypeMilk YieldFat ContentProtein ContentFat Composition
K232 (Lysine)LowerHigherHigherMore saturated
A232 (Alanine)HigherLowerLowerMore unsaturated

The K232 variant exhibits higher enzymatic activity compared to the A232 variant, contributing to increased fat synthesis in the mammary gland. This polymorphism accounts for approximately 50% of the genetic variation in milk fat percentage in some cattle populations. Beyond the K232A substitution, several other polymorphisms in the promoter and coding regions of DGAT1 have been identified, contributing to variations in milk production traits.

These genetic variations in DGAT1 offer valuable tools for marker-assisted selection in dairy breeding programs, allowing for customized selection based on desired milk production characteristics.

What is the role of DGAT1 in metabolic adaptation during the transition period in dairy cows?

During the transition period (3 weeks before to 3 weeks after calving), dairy cows undergo dramatic metabolic adaptations to support lactation. DGAT1 serves several critical functions in this adaptation process:

  • Hepatic lipid metabolism: As negative energy balance induces lipolysis and increases non-esterified fatty acid (NEFA) flux to the liver, DGAT1 helps regulate hepatic lipid accumulation. Its activity influences whether fatty acids are esterified to triacylglycerols for storage, oxidized for energy, or incorporated into VLDL for export .

  • Mammary gland function: DGAT1 is essential for milk fat synthesis in the mammary gland. It catalyzes the final step in triacylglycerol synthesis, which is necessary for milk fat globule formation.

  • Energy partitioning: By influencing the fate of fatty acids in various tissues, DGAT1 contributes to whole-body energy partitioning during this critical period.

Research using liver biopsies has shown that cows diagnosed with fatty liver (average liver TAG = 7.60% of wet weight) exhibit different DGAT1 expression patterns compared to healthy cows (average liver TAG = 0.78%) . These findings suggest that DGAT1 regulation is altered during the development of metabolic disorders in the transition period, potentially offering targets for intervention strategies.

How do DGAT1 and DGAT2 differ in their roles in triacylglycerol synthesis?

DGAT1 and DGAT2, despite catalyzing the same reaction, differ significantly in their evolutionary origin, structure, and functional roles in triacylglycerol synthesis:

  • Evolutionary origin and structure: DGAT1 belongs to the membrane-bound O-acyltransferase (MBOAT) family, while DGAT2 belongs to a distinct acyltransferase family. They share no sequence homology, suggesting independent evolutionary origins .

  • Subcellular localization: Both enzymes localize to the endoplasmic reticulum, but DGAT2 can also localize to lipid droplets, allowing it to utilize the bulk DAG pool that phase partitions into lipid droplets .

  • Substrate utilization: DGAT1 preferentially utilizes the small, initially produced PC-derived DAG pool, possibly through substrate channeling. In contrast, DGAT2 appears to access a larger bulk DAG pool that is not immediately accessible to DGAT1 .

  • Fatty acid preference: DGAT1 generally has preference for monounsaturated fatty acids (18:1, 20:1), while DGAT2 often shows higher activity with polyunsaturated fatty acids (PUFAs) .

  • Metabolic function: In Arabidopsis, mutation studies have shown that DGAT1 is responsible for approximately 80% of triacylglycerol synthesis in seeds, while DGAT2 plays a more specialized role. When DGAT1 is absent (dgat1-1 mutant), PDAT1 (phospholipid:diacylglycerol acyltransferase 1) becomes the major TAG biosynthetic acyltransferase .

These differences suggest that DGAT1 and DGAT2 operate in distinct metabolic pathways, potentially allowing for specialized regulation of triacylglycerol synthesis under different physiological conditions.

What protein-protein interactions are important for DGAT1 function in lipid metabolism networks?

DGAT1 functions within complex lipid metabolic networks, with protein-protein interactions playing crucial roles in substrate channeling and regulatory mechanisms:

  • Self-association: DGAT1 can form homodimers and homotetramers, with both forms exhibiting similar Vmax values in enzymatic assays . This oligomerization may influence enzyme stability, membrane organization, or regulatory properties.

  • Interactions with other lipid metabolism enzymes: Yeast two-hybrid analyses have revealed interactions between plant DGAT1 and other enzymes involved in lipid metabolism, including:

    • Phospholipid:diacylglycerol acyltransferase (PDAT1)

    • Lysophosphatidylcholine acyltransferase (LPCAT)

    • Phosphatidylcholine:diacylglycerol cholinephosphotransferase (PDCT)

  • Metabolic complex formation: These interactions suggest the formation of metabolic complexes or "metabolons" that facilitate substrate channeling between consecutive enzymatic reactions. For example, the interaction between DGAT1 and PDCT may facilitate the channeling of PC-derived DAG directly to DGAT1 for TAG synthesis .

  • Substrate pool accessibility: The protein-protein interactions influence which substrate pools are accessible to DGAT1. Studies in Arabidopsis suggest that DGAT1 utilizes the small initially produced PC-derived DAG pool through substrate channeling, while DGAT2 and PDAT1 utilize a larger bulk DAG pool .

Understanding these protein-protein interactions provides insights into how lipid synthesis is coordinated within cells and how these processes might be manipulated for agricultural or biomedical applications.

How can recombinant DGAT1 be used to study substrate selectivity and catalytic mechanisms?

Recombinant DGAT1 provides a powerful tool for detailed investigation of substrate selectivity and catalytic mechanisms through several methodological approaches:

  • In vitro substrate competition assays: By offering multiple acyl-CoA donors or DAG acceptors simultaneously, researchers can determine relative substrate preferences under controlled conditions. This can be quantified using mass spectrometry to identify specific molecular species of the resulting triacylglycerols.

  • Structure-guided mutagenesis: Based on the solved structure of human DGAT1 , targeted mutations can be introduced to residues involved in substrate binding or catalysis. For example, modifying residues in the FYxDWWN motif allows assessment of their role in acyl-CoA binding.

  • Chimeric enzymes: Creating chimeras between bovine DGAT1 and DGAT1 from other species, or between DGAT1 and DGAT2, helps identify domains responsible for substrate selectivity. For instance, swapping regions between bovine and plant DGAT1 can reveal domains determining preference for saturated versus unsaturated fatty acids.

  • Isotope exchange experiments: Using isotopically labeled substrates, researchers can track the formation of reaction intermediates, providing insights into the reaction mechanism.

  • Molecular dynamics simulations: Computational approaches using the solved DGAT1 structure allow modeling of substrate binding and the identification of transient binding sites that may influence selectivity.

These approaches collectively contribute to understanding how DGAT1 recognizes and processes various substrates, which could inform strategies for modifying milk fat composition through selective breeding or pharmacological approaches.

What are the emerging technologies for studying DGAT1 regulation in real-time in bovine cells?

Several cutting-edge technologies are advancing our ability to study DGAT1 regulation in real-time in bovine cells:

  • Live-cell imaging with fluorescent proteins: DGAT1 can be tagged with fluorescent proteins to track its localization and dynamics in living bovine cells. This approach reveals how DGAT1 redistributes in response to fatty acid availability or hormonal stimulation.

  • FRET/BRET-based biosensors: Förster/bioluminescence resonance energy transfer biosensors can detect DGAT1 protein-protein interactions or conformational changes in real-time, providing insights into regulatory mechanisms.

  • Activity-based protein profiling: Chemical probes that bind to active DGAT1 allow visualization or isolation of the active enzyme pool, distinguishing between total DGAT1 expression and the functionally active fraction.

  • Optogenetics: Light-controlled activation or inhibition of DGAT1 enables precise temporal control over enzyme activity, allowing researchers to dissect the immediate consequences of DGAT1 activation or inhibition.

  • CRISPR-based technologies:

    • CRISPR interference (CRISPRi) for targeted, reversible repression of DGAT1 expression

    • CRISPR activation (CRISPRa) for upregulation of DGAT1 expression

    • CRISPR-based base editing for introduction of specific polymorphisms to study their effects

  • Metabolic flux analysis with stable isotopes: Combined with time-resolved mass spectrometry, this approach tracks the flow of labeled substrates through DGAT1-mediated reactions, revealing how different regulatory factors influence flux through the triacylglycerol synthesis pathway.

These technologies are transforming our understanding of DGAT1 regulation from static snapshots to dynamic processes, revealing how this enzyme responds to the complex metabolic changes occurring during lactation and negative energy balance in dairy cattle.

How can selective inhibition of DGAT1 be utilized in research models of bovine metabolic disorders?

Selective inhibition of DGAT1 offers valuable research approaches for understanding and potentially treating bovine metabolic disorders:

  • Pharmacological inhibitors: Small-molecule DGAT1 inhibitors allow temporal control over enzyme activity in research models. Studies with bovine hepatocytes have utilized DGAT1 inhibitors to assess the role of this enzyme in fatty acid metabolism under metabolic stress conditions . When primary hepatocytes were treated with DGAT1 inhibitor followed by challenge with a fatty acid mixture, researchers could evaluate the specific contribution of DGAT1 to triacylglycerol synthesis and lipid accumulation.

  • Tissue-specific knockdown approaches: RNA interference (RNAi) or antisense oligonucleotides targeting DGAT1 can be delivered to specific tissues like liver or mammary gland to evaluate tissue-specific roles of DGAT1 in metabolic adaptation.

  • Ex vivo precision-cut tissue slices: Liver slices from healthy cows treated with DGAT1 inhibitors can model aspects of fatty liver disease, allowing for comparison with slices from cows with naturally occurring fatty liver.

  • Organoid models: Bovine hepatic or mammary organoids treated with DGAT1 inhibitors provide three-dimensional cellular systems that better recapitulate in vivo tissue architecture and cell-cell interactions.

  • Mathematical modeling: Integration of DGAT1 inhibition data into computational models of bovine metabolism creates predictive frameworks for understanding systemic effects of altered DGAT1 activity.

These approaches help dissect how DGAT1 activity influences lipid partitioning between storage, oxidation, and export pathways, potentially identifying intervention points for preventing or treating metabolic disorders like fatty liver disease in dairy cattle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.