Recombinant Bovine Diacylglycerol O-acyltransferase 2 (DGAT2)

Shipped with Ice Packs
In Stock

Description

Introduction to Diacylglycerol O-acyltransferase 2 (DGAT2)

Diacylglycerol O-acyltransferase 2 (DGAT2) belongs to a family of enzymes that catalyze the final step in triacylglycerol (TAG) biosynthesis. This critical reaction involves the esterification of sn-1,2-diacylglycerol with a long-chain fatty acyl-CoA to form triacylglycerol, a major energy storage molecule in eukaryotes . DGAT2 is one of two DGAT enzymes (DGAT1 and DGAT2) that perform this function, with evidence suggesting that DGAT2 exhibits a higher affinity for its substrates than DGAT1 . While both enzymes catalyze the same reaction, they belong to different gene families with distinct evolutionary origins and exhibit different patterns of expression across tissues.

In bovine systems, DGAT2 plays a particularly significant role in the formation of intramuscular fat (IMF), which is closely related to the tenderness, juiciness, and flavor of beef—important indicators for quality assessment internationally . Triacylglycerols are the major component of intramuscular fat, and DGAT2 expression can significantly influence the rate of TAG synthesis and accumulation . Understanding the function of bovine DGAT2 is therefore crucial for developing strategies to enhance economically valuable traits in beef cattle.

Gene Structure

The DGAT2 gene structure is relatively conserved across mammalian species. In humans, the DGAT2 gene comprises eight exons and spans 42.03 kb on chromosome 11 . It is located approximately 37.5 kb from the MGAT2 gene, which encodes another acyltransferase enzyme . Although the specific genomic details of bovine DGAT2 are not fully characterized in the available literature, comparative genomics suggests a similar organization to that of human DGAT2.

Protein Structure

DGAT2 proteins across species typically range from 350-400 amino acids in length, with calculated molecular masses between 40-44 kDa . DGAT2 is approximately 50 residues longer at the N-terminus compared to other non-DGAT2 members of its gene family, a region that may contain domains conferring substrate specificity or regulatory functions . Human and mouse DGAT2 proteins both consist of 388 amino acids with 95% sequence identity, highlighting the high degree of conservation of this enzyme across mammalian species .

DGAT2 enzymes are integral membrane proteins associated primarily with the endoplasmic reticulum. They exhibit high hydrophobicity, with more than 40% of their amino acid residues being hydrophobic . This characteristic has historically made the purification and structural characterization of DGAT2 challenging, limiting advances in understanding its structure-function relationship .

Conserved Domains and Motifs

Several conserved sequence motifs have been identified in DGAT2 proteins that are likely essential for their function. Table 1 summarizes these key conserved domains and their potential roles.

Table 1: Key Conserved Domains in DGAT2

DomainPositionSequencePotential Function
Putative active site161-164 (mouse)HPHGCatalytic activity; mutations markedly reduce DGAT activity in vitro
Neutral lipid binding domain80-87FLXLXXXn (n=nonpolar)Binding to neutral lipids including diacylglycerol; mutations reduce DGAT activity
Conserved C-terminal region200-360Multiple conserved residuesContains catalytic domains, highly conserved across species

The HPHG sequence (amino acids 161-164 in mouse DGAT2) is highly conserved from yeast to humans and may form part of the active site of DGAT2 . Mutations in this sequence significantly reduce total DGAT activity in vitro, suggesting a crucial role in catalysis . Similarly, the consensus sequence FLXLXXXn (amino acids 80-87), characteristic of a neutral lipid binding domain, may be involved in diacylglycerol binding. This motif is found in various proteins that interact with neutral lipids, including cholesterol ester transfer protein, hormone-sensitive lipase, and lecithin:cholesterol acyltransferase .

Comprehensive sequence analysis of 117 DGAT sequences from 70 organisms revealed that DGAT2s have 16 completely conserved amino acid residues, distributed in 6 sequence blocks located primarily at the carboxyl termini, suggesting the location of catalytic domains . These conserved sequence blocks do not contain the putative neutral lipid-binding domain, mitochondrial targeting signal, or ER retrieval motif .

Recombinant Bovine DGAT2: Production and Characteristics

Recombinant bovine DGAT2 refers to the DGAT2 protein from cattle that has been produced using recombinant DNA technology. This typically involves cloning the bovine DGAT2 gene into an expression vector, which is then introduced into host cells (such as bacteria, yeast, or mammalian cell lines) to produce the protein. The recombinant protein can then be purified and used for various research applications, including enzymatic assays, structural studies, and functional characterization.

The production of recombinant bovine DGAT2 has been accomplished through various approaches. One common method involves constructing adenoviral vectors for overexpression or interference studies. For example, researchers have developed adenovirus overexpression vectors (Ad-DGAT2) by subcloning the cDNA sequence of Yanbian cattle DGAT2 into a shuttle plasmid vector, followed by recombination with an adenovirus backbone plasmid . Similarly, interfering adenovirus vectors (sh-DGAT2) have been constructed by designing short hairpin RNAs targeting the coding sequence region of bovine DGAT2 .

The thermal stability of recombinant DGAT2 proteins can be assessed through accelerated thermal degradation tests . Due to the hydrophobic nature of DGAT2, purification of the protein in its soluble form presents significant challenges, although some studies have reported successful purification of recombinant DGAT2 proteins .

Role in Triacylglycerol Synthesis

As the enzyme catalyzing the final step in TAG biosynthesis, bovine DGAT2 plays a crucial role in lipid metabolism and fat accumulation. Studies have demonstrated that DGAT2 expression determines the rate of TAG synthesis in various tissues, including adipose tissue and skeletal muscle .

In bovine cells, overexpression of DGAT2 leads to significant increases in intracellular TAG content, while knockdown of DGAT2 results in decreased TAG levels . This direct correlation between DGAT2 expression and TAG accumulation underscores the enzyme's critical role in lipid synthesis and storage in bovine systems.

Impact on Adipogenesis

Beyond its direct role in TAG synthesis, bovine DGAT2 also influences adipocyte differentiation and lipid droplet formation. Table 2 summarizes the effects of DGAT2 manipulation on various parameters related to adipogenesis in bovine cells.

Table 2: Effects of DGAT2 Manipulation in Bovine Cells

ParameterDGAT2 OverexpressionDGAT2 Knockdown
Triacylglycerol (TAG) contentSignificantly increasedSignificantly decreased
Adiponectin (ADP) contentSignificantly increasedSignificantly decreased
Lipid droplet formationEnhancedReduced
Adipogenic genes (PPARγ, C/EBPα)UpregulatedDownregulated
Lipid metabolism genes (DGAT1, LPIN1, GPAT4)UpregulatedMostly downregulated
Fatty acid synthesis genes (ACACA, FASN, SCD)UpregulatedVariable effects

Studies in bovine preadipocytes have shown that DGAT2 overexpression significantly increases the expression of peroxisome proliferator-activated receptor γ (PPARγ), CCAAT/enhancer binding protein α (C/EBPα), and fatty acid binding protein 4 (FABP4) at the mRNA level . These genes are key regulators of adipocyte differentiation. Conversely, DGAT2 knockdown reduces the expression of these adipogenic factors . Similar effects have been observed in bovine satellite cells, where DGAT2 overexpression upregulates the expression of PPARγ, C/EBPα, and sterol regulatory element-binding protein 1 (SREBF1) .

Furthermore, DGAT2 influences the formation of lipid droplets in bovine cells. DGAT2 overexpression promotes lipid droplet formation, while DGAT2 knockdown reduces lipid droplet content . This suggests that DGAT2 not only affects the synthesis of TAGs but also their storage in lipid droplets, a critical process in adipocyte development and function.

Overexpression Studies

Overexpression studies have been instrumental in elucidating the functions of bovine DGAT2. Researchers have employed adenoviral vectors to overexpress DGAT2 in various bovine cell types, including preadipocytes and satellite cells . The typical approach involves constructing an adenovirus expression vector containing the bovine DGAT2 coding sequence, followed by infection of target cells.

In a study with Yanbian cattle preadipocytes, cells were transfected with adenovirus supernatants expressing DGAT2 (Ad-DGAT2) and cultured for 96 hours before analysis . The effects on adipocyte differentiation were examined using molecular and transcriptomic techniques. Results showed that DGAT2 overexpression significantly increased intracellular TAG, adiponectin, and lipid droplet contents .

Transcriptome analysis identified 208 differentially expressed genes between DGAT2-overexpressing preadipocytes and normal cells, including 106 upregulated and 102 downregulated genes . This global gene expression profiling approach has provided valuable insights into the cellular pathways affected by bovine DGAT2.

Knockdown Studies

Complementary to overexpression studies, knockdown experiments using RNA interference techniques have helped confirm the specific roles of bovine DGAT2. Researchers have designed short hairpin RNAs (shRNAs) targeting different regions of the bovine DGAT2 coding sequence to suppress its expression .

For example, three shRNAs targeting the CDS region of DGAT2 (DGAT2-sh-108, DGAT2-sh-320, and DGAT2-sh-687) were designed based on the full-length CDS region of Yanbian cattle DGAT2 . After testing their efficacy, DGAT2-shRNA-320 was found to decrease DGAT2 expression in precursor adipocytes by 81.75% and was selected for subsequent experiments .

DGAT2 knockdown resulted in reduced intracellular TAG and lipid droplet content and downregulated the expression of various genes involved in adipocyte differentiation and lipid metabolism, including C/EBPβ, mannosyl (alpha-1,3)-glycoproteinbeta-1,2-N-acetylglucosaminyltransferase (MGAT1), lipin 1 (LPIN1), 1-acylglycerol-3-phosphate O-acyltransferase 4, and acetyl-CoA carboxylase alpha (ACACA) .

Signaling Pathways Affected by Bovine DGAT2

Transcriptomic analyses have revealed that bovine DGAT2 influences various signaling pathways related to lipid metabolism and adipocyte differentiation. Table 3 summarizes the key pathways enriched in DGAT2 overexpression studies.

Table 3: Pathways Enriched in Bovine DGAT2 Overexpression Studies

PathwayFunctionRelationship to DGAT2
PPAR signaling pathwayRegulates adipogenesis and lipid metabolismDGAT2 affects expression of PPAR target genes
AMP-activated protein kinase (AMPK) pathwayEnergy homeostasis and metabolic regulationInfluenced by DGAT2 expression
Cholesterol metabolismSynthesis and regulation of cholesterolDifferentially expressed genes involved in this pathway
Fatty acid biosynthesisProduction of fatty acidsDGAT2 affects expression of fatty acid synthesis genes
Glycerolipid metabolismSynthesis and degradation of glycerolipidsDGAT2 directly participates in this pathway

Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway analysis has shown that genes differentially expressed in response to DGAT2 overexpression are mainly enriched in the PPAR signaling pathway, the AMP-activated protein kinase (AMPK) pathway, cholesterol metabolism, and fatty acid biosynthesis . These findings highlight the broad impact of DGAT2 on cellular metabolism beyond its direct role in TAG synthesis.

The PPAR signaling pathway is particularly relevant, as PPARγ is a master regulator of adipogenesis. DGAT2 overexpression upregulates PPARγ expression , suggesting that DGAT2 may promote adipocyte differentiation in part through activation of PPAR signaling.

In contrast, knockdown of DGAT2 in bovine satellite cells revealed enrichment of differentially expressed genes in pathways such as the Hippo and TGF-β signaling pathways . The Hippo signaling pathway inhibits adipogenesis by suppressing the transcriptional activity of PPARγ, which may explain the inhibition of adipocyte differentiation observed in DGAT2-knockdown cells .

Applications and Implications of Bovine DGAT2 Research

Research on recombinant bovine DGAT2 has several important applications and implications:

  1. Enhancement of beef quality: Understanding the role of DGAT2 in intramuscular fat deposition provides insights for breeding strategies aimed at improving beef marbling, tenderness, and flavor .

  2. Molecular breeding: Identifying candidate genes involved in preadipocyte differentiation and proliferation, such as DGAT2, can promote the breeding of cattle with desirable traits .

  3. Metabolic engineering: Manipulation of DGAT2 expression could potentially be used to modify lipid metabolism in cattle, enhancing economically valuable traits such as milk fat content or meat quality .

  4. Biomedical applications: Given the evolutionary conservation of DGAT2 across species, insights from bovine DGAT2 research may be relevant to understanding lipid metabolism disorders in humans .

  5. Biomolecular tools: Recombinant bovine DGAT2 proteins can serve as valuable tools for enzymatic assays, inhibitor screening, and structural studies .

The research on bovine DGAT2 provides a theoretical basis for further improvement of bovine genome annotation and molecular breeding strategies . By understanding how DGAT2 regulates fat metabolism, it may be possible to develop approaches for producing high-quality marbled beef more efficiently.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DGAT2; Diacylglycerol O-acyltransferase 2; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DGAT2
Target Protein Sequence
MKTLIAAYSGVLRGTGSSILSALQDLFSVTWLNRAKVEKQLQVISVLQWVLSFLVLGVAC SVILMYTFCTDCWLIAVLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKT HNLLTSRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREY LMSGGICPVNRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLAL RHGADLVPTYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGL VPYSKPITTVVGEPITIPRLERPTQQDIDLYHAMYVQALVKLFDQHKTKFGLPETEVLEV N
Uniprot No.

Target Background

Function
Diacylglycerol O-acyltransferase 2 (DGAT2) is an essential acyltransferase catalyzing the final and committed step in triacylglycerol synthesis. It utilizes diacylglycerol and fatty acyl-CoA as substrates. DGAT2 is crucial for intracellular triglyceride synthesis and storage, playing a central role in cytosolic lipid accumulation. In the liver, it primarily incorporates endogenously synthesized fatty acids into triglycerides. It also functions as an acyl-CoA retinol acyltransferase (ARAT) and can utilize 1-monoalkylglycerol (1-MAkG) as an acyl acceptor to synthesize monoalkyl-monoacylglycerol (MAMAG).
Gene References Into Functions
  1. Associations between single nucleotide polymorphisms (SNPs) in introns 6 and 7 of the bovine DGAT2 gene and growth traits in purebred Nanyang cattle were identified. PMID: 17681922
  2. A study on DGAT2 gene polymorphisms in 92 Jiaxian red cattle indicated a potential positive effect of genotype AB on body weight. PMID: 18332002
Database Links
Protein Families
Diacylglycerol acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lipid droplet. Cytoplasm, perinuclear region.

Q&A

What is the primary function of bovine DGAT2 in lipid metabolism?

Bovine DGAT2 catalyzes the final and committed step of triacylglycerol (TG) biosynthesis by transferring an acyl group from acyl-CoA to diacylglycerol (DAG). This enzyme is critical for the synthesis of triacylglycerols, which are major components of intramuscular fat in cattle. The rate of TAG synthesis is largely determined by DGAT2 expression levels, making it a rate-limiting enzyme in this pathway. DGAT2 primarily functions in the endoplasmic reticulum (ER) under normal conditions but can relocate to lipid droplets when cells are incubated with fatty acids, enabling localized TG synthesis for lipid droplet expansion .

How does the structure of recombinant bovine DGAT2 influence its function?

Recombinant bovine DGAT2 is an integral membrane protein with two transmembrane domains that are essential for its functionality. These domains are particularly important for protein-protein interactions, as demonstrated in deletion mutagenesis studies where removal of these transmembrane regions disrupted DGAT2's ability to interact with other proteins such as MGAT2. The structural arrangement of DGAT2 facilitates the formation of both homodimers (~90 kDa) and larger protein complexes (~650 kDa), which have been confirmed through chemical cross-linking experiments using disuccinimidyl suberate (DSS) . This oligomerization appears to be important for coordinating triacylglycerol synthesis with other lipid metabolism enzymes.

What expression systems are most effective for producing recombinant bovine DGAT2?

The most effective expression systems for producing functional recombinant bovine DGAT2 include mammalian cell lines like HEK-293T, COS-7, and McArdle RH7777 cells. These systems provide the appropriate post-translational modifications and membrane environment required for proper DGAT2 folding and activity. For transient transfection, a protocol using polyethylenimine has proven effective: 20 μg of DGAT2 plasmid DNA should be incubated with 430 μl of 0.15 M NaCl and 120 μl of 0.1% polyethylenimine (pH 7.0) for 10 minutes at room temperature before adding to cells at approximately 50% confluency . This approach typically yields functional protein expression within 24-48 hours. Alternative expression systems such as insect cells can be used, but mammalian systems generally provide protein with higher enzymatic activity due to more appropriate post-translational modifications.

What are the most reliable methods for assessing DGAT2 enzyme activity in vitro?

The most reliable methods for assessing recombinant bovine DGAT2 enzyme activity in vitro involve measuring the incorporation of radiolabeled substrates into triacylglycerol. A standard assay utilizes [14C]oleoyl-CoA and diacylglycerol as substrates, with the reaction products separated by thin-layer chromatography and quantified by scintillation counting. For a more high-throughput approach, fluorescently labeled acyl-CoA analogs can be used, with product formation measured by HPLC or fluorescence detection.

When assessing DGAT2 activity in cellular contexts, researchers commonly measure intracellular triacylglycerol (TAG) content following DGAT2 overexpression or knockdown. Studies have demonstrated that DGAT2 overexpression significantly increases intracellular TAG content (p < 0.05) in bovine preadipocytes, while DGAT2 knockdown reduces TAG accumulation . These functional assays should be complemented with appropriate controls and validation of DGAT2 expression levels via Western blotting to ensure result reliability.

How can protein-protein interactions of DGAT2 be effectively studied?

Protein-protein interactions of bovine DGAT2 can be effectively studied through multiple complementary approaches:

  • Chemical cross-linking: Using membrane-permeable cross-linkers such as disuccinimidyl suberate (DSS) at concentrations between 10-500 μM. This approach has successfully demonstrated that DGAT2 forms both dimers (~90 kDa) and larger protein complexes (~650 kDa) .

  • Co-immunoprecipitation: Using epitope-tagged DGAT2 (e.g., FLAG-tagged) to pull down interacting proteins, followed by immunoblotting to detect specific binding partners. This method has confirmed the interaction between DGAT2 and MGAT2 .

  • In situ proximity ligation assay: This technique allows visualization of protein interactions in their native cellular environment and has been successfully applied to detect DGAT2-MGAT2 interactions .

  • Fluorescence microscopy with co-localization analysis: Co-expression of fluorescently tagged DGAT2 with potential interacting partners allows for assessment of spatial proximity within cellular compartments including the ER and lipid droplets.

These methods should be used in combination to provide robust evidence of protein interactions, as each approach has distinct strengths and limitations.

What protocols are recommended for generating DGAT2 mutants for structure-function analysis?

For structure-function analysis of bovine DGAT2, site-directed mutagenesis using PCR-based methods with PfuUltra DNA polymerase has proven effective. The recommended protocol includes:

  • Design primers containing the desired mutation flanked by 15-20 nucleotides of correct sequence on each side

  • Perform PCR using plasmid containing wild-type DGAT2 as template

  • Treat amplified product with DpnI to digest methylated parental DNA

  • Transform competent E. coli with the reaction mixture

  • Select and screen colonies for the presence of mutations by sequencing

  • Validate mutant protein expression by Western blotting following transfection into mammalian cells

Deletion mutagenesis has revealed that the two transmembrane domains of DGAT2 are particularly important for its interaction with MGAT2 . When designing DGAT2 mutants, researchers should consider targeting conserved motifs, potential catalytic residues, and regions involved in protein-protein interactions or subcellular localization. Following mutagenesis, comprehensive functional assessment should include enzyme activity assays, subcellular localization studies, and protein interaction analyses to fully characterize the impact of mutations.

How does DGAT2 regulate bovine preadipocyte differentiation?

DGAT2 plays a crucial regulatory role in bovine preadipocyte differentiation through multiple mechanisms:

  • Upregulation of adipogenic transcription factors: DGAT2 overexpression significantly increases (p < 0.05) the expression of key adipogenic factors including PPARγ, C/EBPα, and SREBF1, which are master regulators of adipocyte differentiation .

  • Promotion of lipid droplet formation: High expression of DGAT2 directly promotes lipid droplet formation and triglyceride accumulation in bovine preadipocytes, which are hallmarks of adipocyte maturation .

  • Modulation of signaling pathways: Transcriptomic analysis has revealed that DGAT2 influences multiple signaling pathways involved in adipogenesis, including PPAR signaling, AMPK pathways, and fatty acid biosynthesis pathways .

The regulatory effect of DGAT2 appears to be bidirectional, as DGAT2 knockdown reduces intracellular TAG and lipid droplet content while downregulating (p < 0.05) adipogenic factors such as C/EBPβ and lipogenic enzymes including LPIN1 and ACACA . This suggests that DGAT2 is not merely a downstream effector but also plays a feedforward role in promoting the entire adipogenic program.

What transcriptomic changes occur in bovine adipocytes following DGAT2 overexpression?

Key pathways enriched among these DEGs include:

  • PPAR signaling pathway - critical for adipogenesis

  • AMP-activated protein kinase pathway - regulator of cellular energy homeostasis

  • Cholesterol metabolism - related to membrane biogenesis during adipocyte formation

  • Fatty acid biosynthesis - essential for triglyceride formation

In contrast, DGAT2 knockdown resulted in 378 DEGs (230 upregulated, 148 downregulated) compared to controls . These DEGs were enriched in pathways that negatively regulate adipogenesis, including:

  • Hippo signaling pathway - inhibits adipogenesis by suppressing PPARγ activity

  • TGF-β signaling pathway - limits differentiation potential of preadipocytes

  • cAMP signaling pathway - modulates cellular metabolism and differentiation

These transcriptomic changes highlight DGAT2's role as a key regulator of bovine adipocyte differentiation through multiple cellular pathways.

What methodological approaches can be used to study DGAT2's role in bovine fat metabolism?

To comprehensively study DGAT2's role in bovine fat metabolism, researchers should employ a multi-tiered methodological approach:

  • Genetic manipulation of DGAT2 expression:

    • Overexpression using adenoviral vectors (such as Ad-DGAT2) with titers of approximately 1 × 10^9 PFU/mL

    • RNA interference using shRNA targeting the CDS region of DGAT2 (effective targets include positions 108, 320, and 687 in the Yanbian cattle DGAT2 sequence)

  • Lipid content analysis:

    • Measurement of intracellular triacylglycerol using enzymatic kits

    • Visualization and quantification of lipid droplets using Oil Red O staining

    • Assessment of adiponectin levels as markers of adipocyte maturation

  • Gene expression analysis:

    • qRT-PCR for adipogenic transcription factors (PPARγ, C/EBPα, C/EBPβ)

    • Western blotting for lipid metabolism enzymes (DGAT1, LPIN1, GPAT4)

    • RNA sequencing for comprehensive transcriptomic profiling

  • Pathway analysis:

    • KEGG pathway enrichment analysis of differentially expressed genes

    • Validation of key pathway components through inhibitor studies

    • Protein-protein interaction mapping using co-immunoprecipitation and proximity ligation assays

This integrated approach has successfully demonstrated that DGAT2 regulates preadipocyte differentiation and lipid accumulation by mediating the expression of genes related to adipose differentiation, lipid metabolism, and fatty acid synthesis .

How does DGAT2 interact with MGAT2 to coordinate triacylglycerol synthesis?

DGAT2 and MGAT2 interact in a coordinated manner to enhance triacylglycerol synthesis through substrate channeling. Co-immunoprecipitation experiments and in situ proximity ligation assays have demonstrated that these enzymes physically interact . This interaction is dependent on the two transmembrane domains of DGAT2, as deletion mutagenesis studies have shown that these domains are essential for MGAT2 binding .

The functional significance of this interaction is evident in co-expression studies, where simultaneous expression of DGAT2 and MGAT2 results in increased TG storage compared to expression of either enzyme alone . This synergistic effect likely occurs because MGAT2 synthesizes diacylglycerol, which is then directly utilized by DGAT2 for triacylglycerol synthesis without requiring diffusion of the intermediate substrate. The spatial arrangement of this enzyme complex facilitates efficient substrate channeling, as both enzymes co-localize in the ER and on lipid droplets .

Importantly, when McArdle rat hepatoma RH7777 cells are incubated with 2-monoacylglycerol, DGAT2 translocates to lipid droplets and forms large cytosolic lipid droplets, indicating that DGAT2 can efficiently utilize monoacylglycerol-derived diacylglycerol produced by MGAT2 . This dynamic interaction demonstrates how lipid synthesis enzymes form functional complexes to enhance metabolic efficiency.

What factors influence DGAT2 translocation between the ER and lipid droplets?

The translocation of DGAT2 between the endoplasmic reticulum and lipid droplets is influenced by several key factors:

  • Fatty acid availability: When cells are incubated with oleate or other fatty acids, DGAT2 relocates from the ER to lipid droplets to facilitate localized triacylglycerol synthesis . This substrate-driven translocation appears to be a regulatory mechanism to enhance lipid storage when fatty acid supply is abundant.

  • Monoacylglycerol exposure: Incubation of cells with 2-monoacylglycerol triggers DGAT2 translocation to lipid droplets, suggesting that substrate intermediates in the glycerolipid synthesis pathway can influence DGAT2 localization .

  • Protein interactions: The association of DGAT2 with other enzymes such as MGAT2 may facilitate its translocation between cellular compartments, as co-expression studies have shown that these proteins co-localize on both the ER and lipid droplets .

  • Oligomerization state: Chemical cross-linking experiments have revealed that DGAT2 forms dimers and larger protein complexes on both the ER and lipid droplets, with potentially differential oligomerization patterns between these compartments. More DGAT2 dimer has been observed in the lipid droplet fraction compared to membrane fractions , suggesting that the oligomerization state may influence subcellular localization.

Interestingly, studies have shown that while fatty acid availability triggers DGAT2 translocation, stimulating TG synthesis with oleate does not appear to increase DGAT2 oligomer abundance . This suggests that the translocation and oligomerization of DGAT2 may be regulated by distinct mechanisms.

How can chemical cross-linking be optimized to study DGAT2 protein complexes?

Optimizing chemical cross-linking for studying DGAT2 protein complexes requires careful consideration of multiple parameters:

  • Cross-linker selection and concentration: Disuccinimidyl suberate (DSS) has proven effective for DGAT2 complex analysis. Titration experiments have shown that DSS concentrations between 10-500 μM are suitable, with higher concentrations resulting in decreased monomeric DGAT2 abundance and increased complex formation . A concentration-dependent approach is recommended to capture different oligomeric states.

  • Sample preparation conditions:

    • For membrane preparations: Total cellular membranes should be resuspended at 1 μg/μl protein in 10 mM Hepes (pH 7.4)/1 mM EDTA buffer

    • For intact cells: Cells should be washed with PBS before cross-linker application

    • For lipid droplet fractions: Cells should first be incubated with 0.5 mM oleate for 12h to stimulate lipid droplet formation before cross-linking

  • Reaction conditions: Cross-linking reactions should proceed for 30 minutes at room temperature and be terminated by adding 1/10 volume of 1 M Tris-Cl (pH 8.0) .

  • Analysis methods: SDS-PAGE using gradient gels (4-20%) is recommended for resolving high molecular weight complexes, followed by immunoblotting with antibodies against epitope tags (e.g., anti-FLAG) or specific DGAT2 antibodies.

  • Controls: Parallel samples without cross-linker and samples with irrelevant membrane proteins should be included as controls for specificity.

This optimized cross-linking approach has successfully demonstrated that DGAT2 forms both dimers (~90 kDa) and larger protein complexes (~650 kDa) in membranes and on lipid droplets , providing valuable insights into the quaternary structure of this important lipid synthesis enzyme.

What is the rationale for targeting DGAT2 in metabolic disorders?

The rationale for targeting bovine DGAT2 in metabolic disorders stems from its critical role as the rate-limiting enzyme in triacylglycerol synthesis. DGAT2 overexpression significantly increases intracellular TAG, adiponectin, and lipid droplet contents (p < 0.05), while also upregulating adipogenic and lipogenic gene expression . Conversely, DGAT2 inhibition or knockdown reduces lipid accumulation, making it a promising therapeutic target for conditions characterized by excessive fat deposition.

In human clinical research, DGAT2 inhibitors are being evaluated for treating non-alcoholic steatohepatitis (NASH) and liver fibrosis . The scientific rationale includes:

  • Reduction of hepatic triglyceride accumulation: By inhibiting the final step of TG synthesis, DGAT2 inhibitors can potentially reduce hepatic steatosis

  • Modulation of metabolic signaling pathways: DGAT2 influences PPAR signaling, AMPK pathways, and fatty acid metabolism

  • Targeted approach: Unlike broader metabolic interventions, DGAT2 inhibition specifically targets triglyceride synthesis without necessarily affecting other essential lipid pathways

Phase II clinical trials are evaluating DGAT2 inhibitors alone or in combination with other agents (such as ACCi) in adults with biopsy-confirmed NASH and liver fibrosis stages 2-3 . While this research is primarily focused on human applications, the insights gained from bovine DGAT2 studies provide valuable comparative information on the fundamental biology of this enzyme across species.

How can recombinant bovine DGAT2 be used to screen for potential inhibitors?

Recombinant bovine DGAT2 provides an excellent platform for screening potential inhibitors through the following methodological approaches:

  • In vitro enzyme assays: Purified recombinant bovine DGAT2 can be used in biochemical assays measuring the conversion of diacylglycerol and acyl-CoA to triacylglycerol. Inhibitor candidates can be evaluated based on their IC50 values and inhibition kinetics. The assay typically utilizes [14C]oleoyl-CoA as a substrate, with products separated by thin-layer chromatography.

  • Cell-based assays with overexpressed DGAT2: HEK-293T, COS-7, or McArdle RH7777 cells transfected with bovine DGAT2 can be used to screen compounds in a cellular context. Following treatment with potential inhibitors, researchers can measure:

    • Intracellular triacylglycerol content

    • Lipid droplet formation visualized by microscopy

    • Expression of lipogenic genes regulated by DGAT2

  • Protein interaction disruption assays: Since DGAT2 forms complexes with MGAT2 and other proteins , compounds that disrupt these interactions may serve as allosteric inhibitors. Co-immunoprecipitation or proximity ligation assays can detect such disruptions.

  • Structure-guided screening: Although a complete crystal structure of bovine DGAT2 is not available, homology models based on related acyltransferases can guide rational inhibitor design. Virtual screening followed by experimental validation has proven successful for related enzymes.

When screening inhibitors, it's important to establish both bovine and human DGAT2 assays to identify species-specific differences in inhibitor sensitivity, as these may impact translational research. Additionally, counter-screening against DGAT1 is essential to identify inhibitors with selectivity for DGAT2.

What considerations are important when designing clinical studies involving DGAT2 inhibitors?

When designing clinical studies involving DGAT2 inhibitors, several important considerations should be addressed based on current research approaches:

  • Patient selection and stratification: Current phase II studies evaluating DGAT2 inhibitors in NASH employ a triage approach with double-confirmation via non-invasive markers prior to screening/baseline liver biopsy . This methodology ensures appropriate patient selection and reduces unnecessary invasive procedures.

  • Dosing strategy: Studies are evaluating DGAT2 inhibitors at multiple dose levels (25–300 mg BID or 150–300 mg once daily), highlighting the importance of dose-ranging approaches to identify optimal therapeutic windows .

  • Combination therapy potential: Co-administration strategies, such as DGAT2i (150–300 mg BID) + ACCi (5–10 mg BID), should be considered based on preclinical evidence of enhanced efficacy with combination approaches .

  • Study duration: Current trials employ a 48-week double-blind, double-dummy dosing period following a ≥6-week run-in period , reflecting the chronic nature of metabolic disorders and the time required to observe meaningful histological changes.

  • Biomarker selection: Both invasive (liver biopsy) and non-invasive biomarkers should be incorporated to comprehensively assess treatment effects on:

    • Hepatic fat content (quantitative imaging)

    • Inflammatory markers

    • Fibrosis markers

    • Metabolic parameters (lipid profiles, insulin sensitivity)

  • Safety monitoring: Special attention should be paid to potential off-target effects, particularly in adipose tissue, skeletal muscle, and cardiac tissue, where altered lipid metabolism might have unintended consequences.

  • Cross-species considerations: Insights from bovine DGAT2 research should inform human studies, particularly regarding potential species differences in enzyme function, regulation, and inhibitor sensitivity.

This structured approach to clinical study design reflects the complexity of targeting lipid metabolism enzymes and the need for comprehensive assessment of both efficacy and safety parameters.

What are the knowledge gaps in understanding the regulation of bovine DGAT2?

Despite significant advances in bovine DGAT2 research, several critical knowledge gaps remain:

  • Post-translational modifications: The role of phosphorylation, glycosylation, and other modifications in regulating bovine DGAT2 activity and localization remains poorly characterized. Identification of specific modification sites and their functional consequences would enhance our understanding of DGAT2 regulation.

  • Transcriptional control mechanisms: While DGAT2 overexpression affects numerous downstream genes, the upstream transcription factors and epigenetic mechanisms controlling DGAT2 expression in different bovine tissues are not fully elucidated.

  • Tissue-specific isoforms and splice variants: Potential tissue-specific variants of DGAT2 in different bovine tissues (adipose, liver, mammary gland) may have distinct regulatory properties that remain to be characterized.

  • Breed-specific variations: Studies in Yanbian cattle have provided valuable insights , but comprehensive comparative analyses across different cattle breeds are needed to understand genetic variations that might influence DGAT2 function and regulation.

  • Nutritional and hormonal regulation: The influence of different dietary components and hormonal states on bovine DGAT2 expression and activity requires further investigation, particularly in the context of feeding regimens relevant to beef production.

  • Interaction with lipid droplet proteins: While DGAT2 relocates to lipid droplets, its interactions with lipid droplet-specific proteins (perilipins, ATGL, etc.) in bovine cells remain to be fully characterized.

Addressing these knowledge gaps would provide a more comprehensive understanding of bovine DGAT2 regulation and potentially reveal novel approaches for modulating its activity in agricultural and biomedical applications.

How might gene editing technologies be applied to study DGAT2 function in bovine models?

Gene editing technologies offer powerful approaches for studying DGAT2 function in bovine models:

  • CRISPR-Cas9 for precise genomic modifications:

    • Generation of knockout bovine cell lines by targeting critical exons of DGAT2

    • Introduction of point mutations to study structure-function relationships

    • Creation of reporter gene knock-ins to monitor DGAT2 expression in real-time

    • Engineering of tagged DGAT2 variants at endogenous loci for protein localization studies

  • Base editing and prime editing applications:

    • Introduction of specific amino acid substitutions without double-strand breaks

    • Correction or introduction of naturally occurring bovine DGAT2 variants

    • Modification of regulatory elements controlling DGAT2 expression

  • Inducible expression systems:

    • Development of doxycycline-inducible DGAT2 expression to study temporal aspects of its function

    • Tissue-specific promoters to restrict DGAT2 manipulation to adipose, liver, or other relevant tissues

  • High-throughput screening approaches:

    • CRISPR interference (CRISPRi) or activation (CRISPRa) libraries targeting DGAT2 regulators

    • Pooled CRISPR screens to identify synthetic lethal interactions with DGAT2

  • In vivo applications:

    • Generation of bovine embryos with DGAT2 modifications using somatic cell nuclear transfer

    • Ex vivo editing of bovine adipose tissue explants to study DGAT2 in a more physiological context

These approaches would complement existing methods and provide more precise tools for understanding DGAT2's role in bovine lipid metabolism, potentially leading to applications in animal agriculture for improving meat quality through targeted modification of intramuscular fat deposition.

What emerging technologies could advance our understanding of DGAT2 in spatial and temporal contexts?

Several emerging technologies have the potential to significantly advance our understanding of DGAT2 in spatial and temporal contexts:

  • Advanced imaging techniques:

    • Super-resolution microscopy (STORM, PALM) to visualize DGAT2 localization beyond the diffraction limit

    • Correlative light and electron microscopy (CLEM) to connect DGAT2 localization with ultrastructural features

    • Live-cell imaging with genetically encoded fluorescent tags to track DGAT2 dynamics in real-time

    • FRET/FLIM approaches to monitor DGAT2 protein interactions with nanometer resolution

  • Spatial transcriptomics and proteomics:

    • Single-cell RNA sequencing of bovine adipose tissue to capture heterogeneity in DGAT2 expression

    • Spatial proteomics to map DGAT2 protein distribution across subcellular compartments

    • Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity of DGAT2 within specific organelles

  • Metabolic flux analysis:

    • Stable isotope-labeled substrates combined with mass spectrometry to track lipid metabolism dynamics

    • Computational modeling of DGAT2-mediated metabolic flux under different physiological conditions

    • Integration of lipidomics data with DGAT2 expression/activity for systems-level understanding

  • Organoid and microphysiological systems:

    • Bovine adipose or liver organoids to study DGAT2 in a 3D tissue-like environment

    • Organ-on-chip technologies to investigate DGAT2 in the context of tissue-tissue interactions

    • Bioprinting approaches to create defined spatial arrangements of cells expressing different levels of DGAT2

  • Optogenetic and chemogenetic tools:

    • Light-controllable DGAT2 expression or activity to study temporal aspects of lipid metabolism

    • Rapidly inducible protein degradation systems to acutely deplete DGAT2

These emerging technologies would provide unprecedented insights into how DGAT2 functions within the complex spatial architecture of cells and tissues, and how its activity changes over time in response to various physiological stimuli, advancing both basic science understanding and potential applications in agricultural and biomedical fields.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.