Recombinant Bovine Dihydroorotate dehydrogenase (quinone), mitochondrial (DHODH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DHODH; Dihydroorotate dehydrogenase; quinone, mitochondrial; DHOdehase; Dihydroorotate oxidase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DHODH
Target Protein Sequence
MAWRQLKKRAQDAMVILGGGGLLFASYLTATGDEHFYAELLMPSLQRLLDPETAHRLAVR FTSLGLLPRTTFQDSDMLEVRVLGHKFRNPVGIAAGFDKHGEAVDGLYKMGFGFVEIGSV TPEPQEGNPRPRVFRLPEDQAIINRYGFNSHGLSVVEHRLRARQQTQARLTEDGLPLGIN LGKNKTSVDAASDYAEGVRVLGPLADYLVVNVSSPNTAGLRSLQGKAELRRLLTKVLQER DALKVAHKPAVLVKIAPDLTAQDKEDIASVVRELGIDGLIVTNSTVSRPASLQGALRSEP GGLSGKPLRDLSTQTIREMYALTQGRVPIVGVGGVSSGQDALEKIRAGASLVQLYTALTY RGPPVVGGVKRELEALLKEQGFARVTDAIGADHRR
Uniprot No.

Target Background

Function
This recombinant bovine mitochondrial dihydroorotate dehydrogenase (DHODH) catalyzes the conversion of dihydroorotate to orotate using a quinone as the electron acceptor.
Database Links

KEGG: bta:533873

STRING: 9913.ENSBTAP00000055859

UniGene: Bt.7483

Protein Families
Dihydroorotate dehydrogenase family, Type 2 subfamily
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure of bovine DHODH and how does it compare to human DHODH?

Bovine DHODH is a monomeric protein with a molecular weight of approximately 42 kDa as determined by SDS-PAGE . The enzyme belongs to Class 2 DHODHs, which are membrane-bound enzymes that use quinones as electron acceptors. The bovine enzyme shares significant structural similarity with human DHODH, both containing a large C-terminal α/β barrel domain and a smaller N-terminal helical domain .

The native bovine liver mitochondrial DHODH has been purified to homogeneity in six steps with a 6,000-fold purification . Structurally, both bovine and human DHODH contain FMN as a prosthetic group, which is essential for the electron transfer reaction during catalysis .

What is the catalytic mechanism of bovine mitochondrial DHODH?

Bovine DHODH catalyzes the oxidation of dihydroorotate to orotate in a two-step reaction:

  • In the first part of the reaction, electrons are transferred from dihydroorotate (DHO) to the flavin mononucleotide (FMN) moiety, resulting in the oxidation of DHO to orotate (ORO) .

  • In the second part, after orotate dissociates from the enzyme, the reduced FMN (FMNH₂) is regenerated by transferring electrons to ubiquinone (coenzyme Q) .

The reaction can be represented as:

Dihydroorotate + Ubiquinone → Orotate + Ubiquinol

This catalytic mechanism links pyrimidine biosynthesis to the mitochondrial respiratory chain, as the electrons ultimately contribute to the electrochemical gradient through complexes III and IV activities .

What are the standard methods for expressing recombinant bovine DHODH?

Recombinant bovine DHODH can be expressed using several systems:

  • Bacterial Expression System: The gene encoding bovine DHODH can be cloned into an expression vector (such as pET series) with an inducible promoter (like T7 lac) and transformed into E. coli strains lacking endogenous DHODH activity . Expression is typically induced using IPTG.

  • Insect Cell Expression: For higher eukaryotic proteins like bovine DHODH, baculovirus expression vector systems in insect cells can provide better post-translational modifications and folding .

  • Mammalian Cell Expression: Although less common for enzyme production, mammalian cell systems can be used when authentic post-translational modifications are critical.

What is the optimal purification strategy for obtaining active recombinant bovine DHODH?

A methodological approach to purifying recombinant bovine DHODH typically involves:

  • Cell Lysis: Bacterial cells expressing DHODH are lysed using techniques such as sonication or pressure homogenization in a buffer containing detergents (usually Triton X-100) to solubilize the membrane-bound enzyme .

  • Affinity Chromatography: If the recombinant protein contains an affinity tag (e.g., His-tag), immobilized metal affinity chromatography (IMAC) can be used. For bovine DHODH, nickel or cobalt resins are commonly employed .

  • Ion Exchange Chromatography: This step helps remove contaminants based on charge differences.

  • Size Exclusion Chromatography: A final polishing step to separate proteins based on size and shape, yielding highly pure DHODH protein.

The purified enzyme is typically stored in a buffer containing glycerol (often 50%) at -20°C or -80°C to maintain stability . It's important to note that repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

How is the enzymatic activity of recombinant bovine DHODH measured in the laboratory?

The standard method for measuring DHODH activity is the DCIP (2,6-dichloroindophenol) reduction assay:

Protocol:

  • Prepare the assay buffer (typically 50 mM Tris-HCl, pH 8.0, 150 mM KCl, 0.1% Triton X-100, and 10% glycerol) .

  • Mix 0.1 mM L-dihydroorotate (substrate), 0.1 mM decylubiquinone (electron acceptor), and 0.1 mM DCIP in the buffer .

  • Add the purified DHODH protein (typically 0.2-0.4 μg/ml final concentration) .

  • Monitor the reduction of DCIP spectrophotometrically at 600 nm (ε = 18,800 M⁻¹ cm⁻¹) .

  • Calculate the specific activity as the rate of DCIP reduction per mg of enzyme.

Alternative electron acceptors such as coenzyme Q10 or FMN can also be used in this assay .

What are the known kinetic parameters for bovine DHODH and how do they compare to human DHODH?

From the available literature, recombinant DHODH enzymes have been characterized with the following kinetic parameters:

Table 1: Comparison of Kinetic Parameters for DHODH Enzymes

ParameterBovine DHODHHuman DHODHB. bovis DHODH
Km for L-DHOSimilar to humanVaries by study, ~200-300 μM276.2 μM
Km for decylubiquinone--94.41 μM
Specific ActivityHigh (reported as 6000-fold purification)Similar to recombinant475.7 ± 245 Unit/mg
pH Optimum-Indicates involvement of histidine residue-

The bovine enzyme shows similar catalytic efficiency to the human enzyme, but may have slightly different substrate specificities. The recombinant human DHODH displays enzymatic behavior similar to the 50-kDa full-length human liver enzyme, even when expressed as a 40-kDa truncated version .

How is bovine DHODH targeted to the mitochondria?

Bovine DHODH, like other animal DHODHs, contains an N-terminal segment that functions as a mitochondrial-targeting sequence . This targeting sequence has a bipartite structure:

  • A cationic portion that is essential for mitochondrial import

  • A hydrophobic segment that ensures correct insertion into the mitochondrial inner membrane

Experimental evidence shows that deletion of the cationic portion blocks import into mitochondria, while deletion of the hydrophobic segment results in mislocalization to the matrix instead of proper insertion into the inner membrane .

What experimental approaches can be used to study the submitochondrial localization of bovine DHODH?

Advanced methodological approaches to determine the submitochondrial localization of bovine DHODH include:

  • Fractionation of Mitochondria: Isolation of mitochondria followed by separation of outer membrane, inner membrane, intermembrane space, and matrix fractions using differential centrifugation and osmotic shock techniques .

  • Protease Protection Assays: Treatment of intact mitochondria with proteases like proteinase K, which can only digest proteins exposed to the cytosol or intermembrane space depending on the integrity of the outer membrane .

  • Immunolocalization: Use of specific antibodies against DHODH combined with markers for different mitochondrial compartments in confocal or electron microscopy . Mitochondria can be labeled with probes like MitoTracker® to confirm co-localization with DHODH .

  • Import Assays with Isolated Mitochondria: In vitro-synthesized bovine DHODH can be incubated with isolated mitochondria to study import mechanisms and requirements such as membrane potential and ATP dependence .

Analysis of fractionated rat liver mitochondria has revealed that DHODH is an integral membrane protein exposed to the intermembrane space, with the catalytic domain facing the intermembrane space while being anchored to the inner membrane .

What are the main classes of DHODH inhibitors and how do they affect bovine DHODH?

Several classes of DHODH inhibitors have been identified:

  • Brequinar and Its Derivatives: Brequinar sodium is a potent noncompetitive inhibitor of mammalian DHODHs, including bovine DHODH, with Ki values in the nanomolar range .

  • Leflunomide and Teriflunomide: These compounds inhibit DHODH activity with IC₅₀ values in the micromolar range. For example, Leflunomide at 1 mM reduced recombinant B. bovis DHODH activity to 51.5% of control .

  • Atovaquone: This inhibitor is highly potent against some parasitic DHODHs and also affects mammalian DHODHs. At 1 μM, it reduced B. bovis DHODH activity to 19.1% of control .

  • Natural Product Inhibitors: Compounds like ascofuranone and its derivatives bind at the ubiquinone binding site and show selective cytotoxicity under certain conditions .

How can one evaluate the inhibitory potential of novel compounds on bovine DHODH?

A comprehensive methodology for evaluating DHODH inhibitors includes:

  • Enzyme Inhibition Assays: Using the DCIP reduction assay with purified recombinant DHODH, novel compounds can be tested at various concentrations to determine IC₅₀ values . The standard protocol involves:

    • Pre-incubating the enzyme with the inhibitor

    • Adding substrate and electron acceptor

    • Measuring the reduction of DCIP spectrophotometrically

    • Calculating percent inhibition relative to a no-inhibitor control

  • Kinetic Analysis: Determining the type of inhibition (competitive, noncompetitive, or uncompetitive) by analyzing enzyme kinetics in the presence of various inhibitor concentrations .

  • Structural Studies: Co-crystallization of DHODH with inhibitors to understand binding modes and structure-activity relationships .

  • Cellular Assays: Testing the effect of inhibitors on cell cultures that rely on de novo pyrimidine biosynthesis. Uridine supplementation can be used to verify that the observed effects are due to DHODH inhibition, as cells can bypass the need for DHODH through the pyrimidine salvage pathway when uridine is available .

Table 2: Example Inhibitory Effects on DHODH Activity

InhibitorConcentrationRelative Activity (%)Inhibition Type
Atovaquone1 μM19.10-
Leflunomide1 mM51.58-
Brequinar0.1 mM106.50 (no inhibition)Noncompetitive
TAZ1 mM101.00 (no inhibition)-

Note: Data shown is for B. bovis DHODH , serving as a comparative example; specific values for bovine DHODH may differ.

What are the key structural features of bovine DHODH that can be targeted for protein engineering?

Bovine DHODH, like other Class 2 DHODHs, has several key structural features:

  • N-terminal Domain: Contains the mitochondrial targeting sequence and membrane-binding region . Modifications to this region can affect subcellular localization and membrane association.

  • FMN Binding Site: Essential for catalytic activity, this highly conserved region binds the FMN cofactor . Mutations in this region typically affect enzyme activity.

  • Dihydroorotate Binding Pocket: The substrate binding site determines specificity and catalytic efficiency. Engineering this region could alter substrate preferences.

  • Ubiquinone Binding Site: The site where electron acceptors bind, which can be targeted for designing selective inhibitors . This site shows greater variability between species compared to the substrate binding site.

  • Histidine Residues: Important for catalytic function, as indicated by the pH dependence of activity and sensitivity to histidine-modifying agents like diethylpyrocarbonate .

How do mutations in DHODH affect enzyme function, and what insights can be gained from studying disease-associated variants?

Studies of DHODH mutations, particularly those associated with Miller syndrome in humans, provide valuable insights into structure-function relationships:

Several human DHODH missense mutations (G19E, E52G, R135C) associated with Miller syndrome have been characterized and show :

  • Decreased Enzymatic Activity: These mutations lead to reduced catalytic efficiency, affecting pyrimidine biosynthesis.

  • Reduced Protein Stability: Mutations can compromise the thermal stability of the enzyme.

  • Altered Mitochondrial Import: Some mutations affect the correct import and localization in the mitochondrial inner membrane.

  • N-terminal Effects: Studies show that the N-terminus is not only important for mitochondrial import but also influences thermal stability, enzymatic activity, and kinetic parameters .

These findings suggest that protein engineering efforts should consider multiple aspects beyond just catalytic activity, including protein stability and subcellular targeting.

How is recombinant bovine DHODH used as a model system for studying human diseases?

Recombinant bovine DHODH serves as a valuable model system for several reasons:

  • Structural Similarity: The high structural similarity between bovine and human DHODH makes bovine DHODH a good model for studying human enzyme function and inhibitor binding .

  • Drug Development: Testing inhibitors against bovine DHODH can provide preliminary data for developing drugs targeting human DHODH in diseases like cancer and autoimmune disorders .

  • Comparative Studies: Differences between bovine and human DHODH can reveal species-specific features that might be important for designing selective inhibitors .

  • Easier Production: In some cases, recombinant bovine DHODH may be easier to express and purify in large quantities compared to the human enzyme, making it useful for initial screening studies .

What innovative approaches are being developed to target DHODH in disease treatment?

Recent advanced research has led to several innovative approaches:

  • Novel Inhibitor Classes: Development of brequinar-based probes and mitochondrial-directed brequinar probes with superior cytotoxicity for cancer research .

  • Combination Therapies: DHODH inhibitors have been shown to cooperate with other drugs, such as molnupiravir and N4-hydroxycytidine, to suppress SARS-CoV-2 replication by depleting cellular pyrimidine pools .

  • Selective Targeting of Cancer Cells: DHODH inhibitors like ascofuranone derivatives show selective cytotoxicity to cancer cells under tumor microenvironment conditions (hypoxia and nutrient deprivation), with selectivity ratios of over 1000-fold compared to normal culture conditions .

  • Structure-Based Drug Design: Co-crystallographic analysis of DHODH with inhibitors has revealed binding modes and structure-activity relationships, enabling the rational design of more potent and selective inhibitors .

  • PROTAC Approach: Development of proteolysis targeting chimeras (PROTACs) based on DHODH inhibitors for targeted protein degradation, representing a new frontier in DHODH-targeted therapeutics .

What are the cutting-edge methods for studying DHODH enzyme dynamics and inhibitor interactions?

Advanced experimental techniques for studying DHODH include:

  • X-ray Crystallography: Co-crystallization of DHODH with substrates, cofactors, or inhibitors provides atomic-level details of binding interactions . This technique has been crucial for understanding how inhibitors like brequinar bind to the enzyme.

  • Cryo-Electron Microscopy: Emerging as a powerful tool for studying membrane proteins like DHODH in their native-like environment without the need for crystallization.

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS): Provides information about protein dynamics and conformational changes upon substrate or inhibitor binding.

  • Surface Plasmon Resonance (SPR): Allows real-time measurement of binding kinetics between DHODH and its inhibitors.

  • Molecular Dynamics Simulations: Computational approach to study protein flexibility and inhibitor binding dynamics over time.

How can multi-omics approaches enhance our understanding of DHODH function in cellular metabolism?

Integrating multiple omics technologies can provide a comprehensive view of DHODH's role:

  • Metabolomics: Measuring changes in pyrimidine metabolites and related pathways in response to DHODH inhibition or genetic manipulation .

  • Proteomics: Identifying DHODH interaction partners and post-translational modifications that regulate its activity.

  • Transcriptomics: Analyzing gene expression changes in response to DHODH inhibition to understand downstream effects on cellular processes.

  • Genomics: Identifying genetic variations in DHODH across species or individuals that may affect enzyme function or inhibitor sensitivity.

  • Systems Biology Integration: Combining these datasets to create computational models of pyrimidine metabolism that can predict the effects of DHODH inhibition in different cellular contexts.

This multi-omics approach has revealed, for example, that under tumor microenvironment conditions, cancer cells heavily depend on the pyrimidine de novo biosynthesis pathway, making DHODH an attractive target for cancer therapy .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.