Recombinant Bovine DNA damage-regulated autophagy modulator protein 2 (DRAM2)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is desired, please communicate your requirement beforehand as additional fees will apply.
Note: All protein shipments are standardly accompanied by blue ice packs. If dry ice shipping is desired, please communicate your requirement beforehand as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For convenient reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration ranging from 0.1 to 1.0 mg/mL. To facilitate long-term storage at -20°C/-80°C, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life extends to 12 months at -20°C/-80°C.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. For lyophilized protein, the shelf life extends to 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DRAM2; TMEM77; DNA damage-regulated autophagy modulator protein 2; Transmembrane protein 77
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DRAM2
Target Protein Sequence
MWWFQQGLSFLPSALVIWTAAAFIFSYITAITLHHVDPVLPYISDTGTVAPEKCLFGAML
NIAAVLCVATIYVRYKQVHALNPEENRIIRLNKAGLVLGLLSCLGLSLVANFQKTTFFAV
HVCGAVLTFGMGSLYMFVQTILSYQMQPKIHGKQVFWIRLLLVIWCGVSAFSMLTCSSLL
YNGSFGADIVQKLHWNPEDKGYVLHMITTAAEWSMSLSFFGFFLTYIRDFQKISLRVEAT
LHGLTLYDTAPCPVNNERTWLLSRDV
Uniprot No.
Target Background
Function
DRAM2 plays a role in the initiation of autophagy. In the retina, it might be involved in the renewal and recycling of photoreceptor cells, a process crucial for maintaining visual function. When co-expressed with DRAM1, it induces apoptotic cell death.
Database Links
Protein Families
DRAM/TMEM150 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Photoreceptor inner segment. Apical cell membrane.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
