Recombinant Bovine DnaJ homolog subfamily B member 12 (DNAJB12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DNAJB12; DnaJ homolog subfamily B member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-370
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYPTPRVHALIESLNQKPQPAGDQ PQPTEATHTTHRKAAGANTASANGEAGGESTKGYTAEQVAAVKRVKQCKDYYEILGVSRG ASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQFGDDKGQA ARHGHGHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYHQRQDRRENQG DGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSLRPSVGHVHKRVTDHLNVVYYVADT FSQEYTGSSLKMVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDADMYNKAQKDGA PQAVTDCQRL
Uniprot No.

Target Background

Function
Recombinant Bovine DnaJ homolog subfamily B member 12 (DNAJB12) functions as a co-chaperone with HSPA8/Hsc70, facilitating protein folding and trafficking, preventing aggregation of client proteins, and directing misfolded proteins to the endoplasmic reticulum-associated degradation (ERAD) pathway. Its mechanism involves modulating HSPA8/Hsc70's ATPase and polypeptide-binding activities. Independently of HSPA8/Hsc70, DNAJB12, in conjunction with DNAJB14, acts as a chaperone promoting the maturation of potassium channels KCND2 and KCNH2 by stabilizing nascent channel subunits and assembling them into tetramers. While HSPA8/Hsc70 is necessary for nascent channel protein stabilization, channel subunit oligomerization proceeds independently of HSPA8/Hsc70. Overexpression results in the formation of membranous structures (DJANGOs) with DNAJB14 and HSPA8/Hsc70 within the nucleus; the function of these structures remains to be fully elucidated.
Database Links
Protein Families
DnaJ family, DNAJB12/DNAJB14 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.

Q&A

What is the cellular localization of bovine DNAJB12 and how can it be experimentally verified?

DNAJB12 is a Type II Hsp40 protein localized to the endoplasmic reticulum (ER) membrane. The protein contains a J-domain and G/F-like region, with its J-domain exposed to the cytosol . To verify this localization:

Methodological approach:

  • Perform subcellular fractionation combined with Western blotting

  • Use immunofluorescence microscopy with co-staining for established ER markers

  • Generate tagged DNAJB12 constructs (preferably N-terminally tagged as C-terminal tags may affect function) and visualize localization

  • Use protease protection assays to confirm membrane topology

When designing these experiments, it's critical to consider that DNAJB12 contains a transmembrane domain and its DUF1977 domain, which contains conserved cysteine residues that may be sensitive to the oxidative/reductive state of the ER lumen .

What protein complexes does DNAJB12 form and how do these facilitate its function?

DNAJB12 forms functional complexes with multiple proteins to coordinate protein quality control.

Key interaction partners:

  • Hsc70/Hsp70: DNAJB12 recruits Hsp70 to the ER surface

  • RMA1 E3 ligase: Works together to regulate protein folding efficiency

  • Derlin-1: Forms complexes involved in ER-associated degradation (ERAD)

  • gp78 and HERP: Part of the ERAD machinery that can also target DNAJB12 itself during ER stress

  • BiP: Small pool detected in complex with DNAJB12, with interaction increasing 4-fold during ER stress

Research methodology: To study these interactions, use co-immunoprecipitation with antibodies against endogenous proteins or epitope-tagged variants. For detecting transient interactions, consider chemical crosslinking prior to immunoprecipitation. Proximity ligation assays can also provide spatial information about these interactions in intact cells.

What are the optimal conditions for expressing and purifying recombinant bovine DNAJB12?

Expression system recommendations:

  • Bacterial expression: Challenging due to DNAJB12's transmembrane domain; consider expressing only the J-domain or using fusion tags that enhance solubility

  • Mammalian expression: HEK293 or CHO cells provide proper post-translational modifications

  • Insect cell expression: Baculovirus system offers a compromise between yield and proper folding

Purification strategy:

  • Use a mild detergent (DDM or CHAPS) for extraction from membranes

  • Affinity chromatography with His-tag or FLAG-tag

  • Size exclusion chromatography to remove aggregates and ensure homogeneity

  • Consider including reducing agents (1-5mM DTT) during purification to maintain cysteine residues, but note that DTT at higher concentrations (>0.6mM) may affect protein stability

Quality control: Verify protein identity and integrity through mass spectrometry and circular dichroism to confirm proper folding.

How can researchers effectively measure DNAJB12's ATPase stimulation activity on Hsp70?

DNAJB12, like other J-domain proteins, stimulates the ATPase activity of Hsp70 chaperones.

Experimental protocol:

  • Reagents needed:

    • Purified recombinant Hsp70 (bovine or human depending on research focus)

    • Purified DNAJB12 (full-length or J-domain)

    • ATP and buffer components (typically HEPES pH 7.4, KCl, MgCl₂)

  • ATPase assay options:

    • Malachite green assay to measure released phosphate

    • NADH-coupled assay for continuous measurement

    • Radiolabeled [γ-³²P]ATP assay for highest sensitivity

  • Controls to include:

    • Hsp70 alone (basal activity)

    • Well-characterized DnaJ protein (positive control)

    • Heat-inactivated DNAJB12 (negative control)

Data analysis: Calculate fold stimulation compared to basal Hsp70 activity and determine kinetic parameters (KM and kcat). The human DNAJB12 J-domain, similar to other Hsp40 proteins like DNAJA1, likely interacts with Hsp70 primarily through helix α2 of the J-domain .

How does DNAJB12 contribute to ERAD and what are the appropriate methods to study this function?

DNAJB12 facilitates ERAD by recruiting Hsp70 to the ER surface and working with ubiquitin ligases to target misfolded proteins for degradation.

Research approaches:

  • Client protein degradation assays:

    • Pulse-chase experiments with cycloheximide to monitor degradation kinetics of known ERAD substrates (e.g., CFTR and CFTRΔF508)

    • Compare degradation rates in wild-type cells versus DNAJB12 knockdown/knockout cells

  • Ubiquitination assays:

    • In vivo: Immunoprecipitate substrate proteins and probe for ubiquitin

    • In vitro: Reconstitute ubiquitination using purified components

  • Client selection mechanisms:

    • Crosslinking studies to capture transient interactions

    • Truncation and point mutation analyses to map interaction domains

Data interpretation considerations: DNAJB12 works with multiple E3 ligases (RMA1, gp78, HRD1) that may have partially redundant functions . Therefore, knockdown of a single E3 ligase may not completely block DNAJB12-dependent degradation.

What is the relationship between DNAJB12 and ER stress, and how can this be experimentally evaluated?

DNAJB12 exhibits a paradoxical relationship with ER stress: while it helps resolve protein misfolding, it is itself degraded during severe ER stress, potentially serving as a regulatory mechanism for stress-induced apoptosis .

Experimental design to study this relationship:

  • ER stress induction methods comparison:

    StressorMechanismEffect on DNAJB12Timeframe for DNAJB12 degradation
    DTT (0.6-1mM)Disrupts disulfide bondsRapid destabilization1.5-2 hours
    Thapsigargin (3-6μM)Depletes ER calciumGradual reduction4-24 hours
    TunicamycinBlocks N-glycosylationMinimal effectN/A
  • Stability assessment:

    • Cycloheximide chase assays: DNAJB12 half-life changes from ~6 hours to ~1.5 hours under DTT treatment

    • Proteasome inhibitors (MG132, bortezomib) can block stress-induced degradation

  • Structural determinants:

    • The DUF1977 domain contains conserved cysteines (positions 329 and 363) that affect stability

    • C363A mutation renders DNAJB12 insensitive to DTT-induced degradation

    • C-terminal tagging (MYC tag) abrogates DTT sensitivity

Research insight: The selective degradation of DNAJB12 during ER stress appears to be a regulated process that may promote BOK accumulation and subsequent apoptosis induction, providing a mechanistic link between protein quality control and cell fate decisions .

How does the interplay between DNAJB12 and BOK impact cell survival, and what are appropriate cell models to study this phenomenon?

DNAJB12 regulates the pro-apoptotic protein BOK, and DNAJB12 degradation during ER stress promotes BOK accumulation and activation of caspases.

Recommended cell models:

  • Huh-7 liver cancer cells: Established model where DNAJB12-BOK interactions have been demonstrated

  • Primary hepatocytes: To validate findings in non-transformed cells

  • Bovine cell lines (MDBK or primary bovine hepatocytes): To study species-specific differences

Experimental approaches:

  • Gene manipulation strategies:

    • siRNA/shRNA for transient or stable DNAJB12 knockdown

    • CRISPR/Cas9 for complete knockout

    • Rescue experiments with wild-type or mutant DNAJB12 (especially C363A)

  • Cell death assessment techniques:

    • Caspase 3, 7, and 9 activity assays

    • PARP cleavage detection

    • Annexin V/PI staining for flow cytometry

    • Real-time monitoring using fluorescent reporters

Important findings to consider: Depletion of DNAJB12 by shRNA sensitizes Huh-7 cells to death caused by proteotoxic agents and proapoptotic chemotherapeutics like LCL-161 . This suggests DNAJB12 may be a potential therapeutic target for enhancing sensitivity to anti-cancer treatments.

What approaches can be used to investigate differences between human and bovine DNAJB12 orthologs?

Comparative analysis methodologies:

  • Sequence and structural analysis:

    • Multiple sequence alignment to identify conserved domains and species-specific variations

    • Homology modeling of bovine DNAJB12 based on available structural data

    • Molecular dynamics simulations to predict functional differences

  • Function-swapping experiments:

    • Create chimeric proteins with domains exchanged between species

    • Test whether bovine DNAJB12 can complement human DNAJB12 knockdown

    • Assess species-specific client protein preferences

  • Interaction network mapping:

    • BioID or APEX proximity labeling to identify species-specific interaction partners

    • Quantitative interactomics under basal and stress conditions

    • Yeast two-hybrid screening with species-specific bait proteins

Research consideration: The DnaJ protein family is highly conserved evolutionarily, with functional complementation possible across species in some cases. For instance, bacterial DnaJ can replace mammalian dj2 (another DnaJ homolog) in mitochondrial protein import and luciferase refolding . Investigating whether similar cross-species functionality exists for DNAJB12 could provide valuable insights into conserved mechanisms of ER quality control.

What strategies can address difficulties in detecting endogenous bovine DNAJB12?

Detection challenges and solutions:

  • Antibody selection:

    • Commercial antibodies against human DNAJB12 may have limited cross-reactivity with bovine orthologs

    • Consider generating custom antibodies against bovine-specific peptide sequences

    • Validate antibodies using DNAJB12 knockout cells as negative controls

  • Protein extraction optimization:

    • Use specialized buffers containing 1-2% digitonin or 1% DDM for membrane protein extraction

    • Include protease inhibitors and freshly prepared reducing agents

    • Avoid freeze-thaw cycles of samples containing DNAJB12

  • Signal enhancement methods:

    • Use high-sensitivity chemiluminescent substrates for Western blotting

    • Consider tyramide signal amplification for immunofluorescence

    • Enrich ER fractions before analysis to concentrate DNAJB12

Special consideration: DNAJB12 levels are regulated by ER stress, so standardize cell culture conditions carefully to ensure consistent basal expression .

How can researchers address the challenge of DNAJB12's rapid degradation during experimental manipulation?

The stress-sensitive nature of DNAJB12 can complicate experimental studies due to its rapid degradation under conditions that induce even mild ER stress.

Practical solutions:

  • Stabilization approaches:

    • Include proteasome inhibitors (MG132, 5-10μM) during short-term experiments

    • Use C-terminally tagged constructs for overexpression studies, as the MYC tag at this position can stabilize DNAJB12 against stress-induced degradation

    • Consider the C363A mutation, which shows altered stability patterns

  • Time course considerations:

    • Limit experimental manipulation time to minimize stress

    • Perform time-course experiments to capture DNAJB12 dynamics

    • Include early time points (30min-2hr) when studying stress responses

  • Stress mitigation:

    • Maintain consistent temperature during experimental procedures

    • Use freshly prepared media and buffers

    • Consider including chemical chaperones (e.g., 4-PBA) to stabilize the ER folding environment

Data interpretation note: When comparing DNAJB12 levels between experimental conditions, always normalize to multiple housekeeping proteins and consider measuring BiP levels as an indicator of ER stress that might influence DNAJB12 stability .

What are the most promising future research directions for bovine DNAJB12?

Based on current knowledge about DNAJB12 function, several promising research avenues emerge:

  • Tissue-specific functions: Investigate whether bovine DNAJB12 has specialized roles in tissues relevant to cattle health and production (mammary gland, muscle, liver)

  • Stress adaptation: Examine how DNAJB12 contributes to cellular adaptation to environmental stresses relevant to livestock (heat stress, metabolic challenges during lactation)

  • Comparative biology: Study species-specific differences in DNAJB12 regulation and client specificity between bovine and human orthologs

  • Therapeutic potential: Explore whether modulating DNAJB12 function can enhance stress resistance in bovine cells or tissues

  • Integration with other quality control systems: Investigate how bovine DNAJB12 interfaces with autophagy and the unfolded protein response in a species-specific manner

Methodological advances needed: Development of bovine-specific tools including validated antibodies, cell lines with DNAJB12 knockdown/knockout, and recombinant protein expression systems will be essential to advance this field.

How might conflicting data regarding DNAJB12 function be reconciled through improved experimental approaches?

Potential sources of conflicting results:

  • Cell type differences:

    • DNAJB12 may have cell type-specific functions and interaction partners

    • Recommendation: Use multiple cell types and primary cells where possible

  • Stress induction variability:

    • Different stressors affect DNAJB12 differently (e.g., DTT vs. thapsigargin vs. tunicamycin)

    • Recommendation: Standardize stress protocols and include multiple stress paradigms

  • Methodology differences:

    • Overexpression vs. knockdown approaches may yield different results

    • Tag position affects DNAJB12 stability and function

    • Recommendation: Use complementary approaches and include untagged controls

  • Species differences:

    • Extrapolating from human to bovine systems may not always be valid

    • Recommendation: Directly compare orthologs in parallel experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.