Recombinant Bovine DnaJ homolog subfamily C member 14 (DNAJC14)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine DnaJ Homolog Subfamily C Member 14 (DNAJC14)

DNAJC14 is a member of the DnaJ/Hsp40 family of proteins, which function as co-chaperones of the Hsp70 chaperone protein . DNAJC14, also known as Hsp40, is involved in various cellular processes, including protein folding, protein trafficking, and stress response . It contains a J domain, which interacts with Hsp70 and modulates its ATPase activity, influencing its ability to bind and release substrate proteins .

DNAJC14 and Protein Secretion

Research indicates that DNAJC14 plays a role in unconventional protein secretion under ER stress conditions . Specifically, DNAJC14 has been shown to target misfolded proteins, such as pendrin, for cell-surface secretion . Pendrin is an anion exchanger, and its misfolding can lead to various cellular dysfunctions .

  • Mechanism of Action DNAJC14 appears to switch the function of Hsc70, diverting substrate proteins like H723R-pendrin from proteasomal degradation to cell-surface secretion . The J protein DNAJC14 may bind to the client protein of folding-deficient H723R-pendrin and bring it to the ATP-bound form of Hsc70 .

Table 1: Impact of DNAJC14 on Cl-/HCO3- Exchange Activity

ConditionΔpH unit min-1
H723R-expressing PANC-1 cells0.039±0.015
H723R-expressing PANC-1 cells with DNAJC140.201±0.034

DNAJC14 and Viral Replication

Studies have explored the role of DNAJC14 in viral replication, particularly in pestiviruses . Pestiviruses are a genus of viruses that affect livestock and can cause significant economic losses .

  • DNAJC14 Independence in Atypical Porcine Pestivirus (APPV) Research suggests that APPV replication is independent of DNAJC14, indicating a fundamental difference in the regulation of NS2-3 cleavage of APPV compared to other pestiviruses .

  • DNAJC14 Dependence in Non-Cytopathic Pestiviruses Non-cytopathic pestiviruses rely on DNAJC14 for their replication . Experiments using CRISPR/Cas9-mediated knockout of DNAJC14 in cells demonstrated that non-cytopathic pestiviruses could not replicate in the absence of DNAJC14 .

DNAJC14 and Genetic Diversity in Cattle

Genetic studies have examined the genetic diversity of the CD14 gene in cattle and its association with clinical mastitis . Clinical mastitis is a common and costly disease in dairy cattle .

  • Single Nucleotide Polymorphisms (SNPs) Multiple sequence alignments of KF CD14 gene sequence with B. taurus cattle sequence revealed several nucleotide changes (SNPs) . These SNPs may be associated with varying degrees of susceptibility to mastitis .

  • Combined Genotypes and Mastitis Certain combined genotypes of the CD14 gene are associated with different levels of mastitis incidence . Cows with the AACD combined genotype were found to be least susceptible to mastitis, while those with the ABDD combined genotype had the highest mastitis incidence .

Table 2: Sequence Identity of KF CD14 Gene with Other Species

SpeciesSequence Identity (%)
Bos taurus86-99
Domestic animals86-99

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
DNAJC14; DnaJ homolog subfamily C member 14; J domain protein interacting with viral protein; Jiv
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-699
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DNAJC14
Target Protein Sequence
MAQKHPGEGGLCGAHHSGGASLRTLGPSVDPDILSFSGLRDSAGSAPNGTRCLTEHSSPK YTQPPNPAHWSDPSHGPPRGPGPPLAEEDPDQSEASSEESGVDQELSRENETGYQDDGNS SFLSIPSTCNCQGTPGIPEGPYSEGRDSSSSNFCHHCTSPALGEDEELEGEYDEEEPLKF PSDVSRVPSEKKPAPRRQRHRVPAKEDTREGGRRDPRSPGRHRLGRKRSQADKRRGLGLW GAEELCQLGQAGFWWLIELLVLVGEYVETCGHLIYACRQLKGSDLDLLRVWVGVWAGRLR GWAQVMFQFLSQGFCYGAGLFTRFLRLVGALLLLALALLLGCLQLGWRFLVGLSDRLGWR DKATWIFSWLASPTWQRCLILLRESRPWQQLVRIVQWGWLELPWVKQRTNRQANAPVAGG RYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPR AEEAFKVLRAAWDIVSNPERRKEYEMKRMAENELSRSVNEFLSKLQEAMNTMMCSRCQGK HRRFEMDREPKSARYCAECNRLHPAEEGDFWAESSMLGLKITYFALMDGKVYDITEWAGC QRVGISPDTHRVPYHISFGSRMPGTSGRQRATPDAPPADLQDFLSRIFQVPPGQMSNGNF FAAPQPGPGATAASKPNSTVPKGEAKPKRRKKVRRPFQR
Uniprot No.

Target Background

Function
Regulates the export of target proteins, such as DRD1, from the endoplasmic reticulum to the cell surface. It also promotes the cleavage of pestivirus polyprotein.
Database Links

KEGG: bta:281691

STRING: 9913.ENSBTAP00000027541

UniGene: Bt.7218

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of bovine DNAJC14 and how does it compare to its human homolog?

Bovine DNAJC14 (also known as Jiv) is a type III Hsp40 chaperone protein characterized by:

  • J-domain with conserved HPD motif critical for stimulating ATPase activity of Hsp70

  • Two zinc-finger motifs downstream of the J-domain

  • C-terminal domain that mediates self-interaction (dimerization)

  • Three potential transmembrane domains

The human homolog shares significant structural similarity, with both proteins containing the J-domain and C-terminal self-interaction domains essential for their function. Sequence alignment shows high conservation of functional domains across species, particularly the J-domain and zinc finger motifs .

What are the primary cellular functions of DNAJC14?

DNAJC14 serves multiple cellular functions:

  • Acts as an Hsp40 co-chaperone that accelerates the ATPase activity of Hsp70

  • Regulates protein folding and quality control in the endoplasmic reticulum (ER)

  • Facilitates protein transport, particularly of transmembrane proteins

  • Mediates unconventional protein trafficking pathways for misfolded proteins

  • Interacts with dopamine D1 receptor to regulate its transport

  • Controls viral replication through interaction with viral proteases

The function of DNAJC14 is highly dependent on the J-domain containing the HPD motif, as mutations in this region (e.g., H471Q, L466P) abolish its chaperone activity and subsequent functionality .

What are the optimal expression systems for producing recombinant bovine DNAJC14?

For recombinant bovine DNAJC14 production, several expression systems have been successfully employed:

Expression SystemAdvantagesLimitationsYieldApplications
E. coliCost-effective, rapid growth, high yieldMay lack proper folding and PTMs2-5 mg/LStructural studies, antibody production
Mammalian cells (HEK293T)Native-like folding, proper PTMsHigher cost, lower yield0.5-1 mg/LFunctional studies, interaction analyses
Baculovirus/insect cellsIntermediate cost, proper foldingModerate complexity1-3 mg/LProtein-protein interaction studies

Methodological considerations:

  • For full-length DNAJC14 with membrane domains, mammalian expression systems are preferred due to proper membrane insertion

  • For truncated versions (e.g., Jiv90 fragment), bacterial expression can be sufficient

  • Addition of a cleavable N-terminal tag (His6 or GST) facilitates purification without interfering with C-terminal interactions

How should researchers optimize purification of recombinant bovine DNAJC14 for functional studies?

Purification of recombinant bovine DNAJC14 requires careful consideration of its membrane association and proper folding:

  • For full-length protein:

    • Solubilization with mild detergents (0.5-1% NP-40 or 1% DDM)

    • Affinity chromatography using N-terminal tags

    • Size exclusion chromatography to isolate properly folded dimers

    • Buffer optimization to maintain stability (10 mM HEPES, pH 7.5, 150 mM KCl, 3 mM MgCl₂)

  • For Jiv90 fragment (amino acids 536-620):

    • Direct lysis in non-denaturing buffers

    • Single-step affinity purification often sufficient

    • Dialysis against physiological buffers

Quality control measures for purified protein:

  • Thermal shift assays to confirm proper folding

  • Size exclusion profiles to verify dimerization state

  • Functional assays measuring interaction with viral NS2 protease

How does bovine DNAJC14 regulate pestivirus replication and what experimental systems best demonstrate this function?

Bovine DNAJC14 (Jiv) plays a critical dual role in pestivirus replication through regulation of the viral NS2-3 processing:

ConditionEffect on Viral ReplicationMechanismViral Phenotype
Normal cellular levelsControlled replicationLimited NS2-3 cleavageNon-cytopathogenic (noncp)
Depletion (knockout)Inhibited replicationBlocked NS2-3 cleavageReplication failure of noncp strains
OverexpressionEnhanced replicationIncreased NS2-3 cleavageCytopathogenic (cp) phenotype

Experimental systems to demonstrate this function:

  • DNAJC14 knockout cell lines (e.g., CRISPR/Cas9-mediated knockout in SK-6 cells)

  • Knock-in cell lines expressing:

    • Wild-type DNAJC14

    • Hyperactive Jiv90 fragment

    • Inactive mutants (e.g., Jiv90 W29A)

  • Viral replication assays using:

    • Wild-type noncp virus

    • Cytopathogenic (cp) virus strains

    • Viral replicon systems

Research findings demonstrate that noncp pestiviruses depend on DNAJC14 for replication, whereas cp strains can replicate independently of this host factor .

Why does APPV replicate in DNAJC14 knockout cells while other pestiviruses cannot?

The atypical porcine pestivirus (APPV) represents a remarkable exception to the DNAJC14 dependency observed in classical pestiviruses:

Experimental evidence:

  • APPV replicates efficiently in DNAJC14 knockout SK-6 cells

  • Control experiments with classical pestiviruses (CSFV) show no replication in identical knockout cells

  • APPV replication kinetics remain unchanged in cells overexpressing the Jiv90 fragment

  • APPV does not develop cytopathogenicity when DNAJC14 is overexpressed

Proposed mechanisms:

  • APPV likely utilizes an alternative cellular cofactor for NS2 autoprotease activation

  • The NS2-3 processing of APPV appears to be regulated differently than in classical pestiviruses

  • The divergent evolution of APPV may have selected for DNAJC14-independent replication mechanisms

Methodological approach to investigate this phenomenon:

  • Genetic engineering of APPV NS2 protease with active site mutations

  • Creation of synthetic APPV genomes with NS3 duplication to bypass NS2-dependent processing

  • Comparative analyses of NS2-3 cleavage in wild-type and DNAJC14 knockout cells

  • Proteomic approaches to identify alternative cofactors

How can researchers harness DNAJC14 as a therapeutic target for viral infections?

DNAJC14's critical role in viral replication makes it a promising therapeutic target:

Research approaches:

  • Small molecule modulators:

    • High-throughput screening assays using NS2-DNAJC14 interaction

    • Structure-based drug design targeting the J-domain or interaction surfaces

    • Repurposing of Hsp70/Hsp40 pathway inhibitors

  • Genetic approaches:

    • Transient overexpression of DNAJC14 to disrupt viral replication stoichiometry

    • CRISPR-based modulation of endogenous DNAJC14 levels

    • Expression of dominant-negative DNAJC14 mutants

  • Peptide-based therapeutics:

    • Jiv90-derived peptides that compete for viral NS2 binding

    • Cell-penetrating peptides targeting DNAJC14-viral protein interactions

Experimental validation systems:

  • Cell culture models with reporter viruses

  • DNAJC14 knockout and complementation systems

  • In vivo models with tissue-specific DNAJC14 modulation

Data from experimental models suggests that transient DNAJC14 overexpression inhibits flavivirus replication in a time- and dose-dependent manner, providing proof-of-concept for therapeutic approaches .

What are the most effective methods for studying DNAJC14's role in unconventional protein trafficking?

DNAJC14 plays a crucial role in unconventional protein trafficking, particularly for misfolded proteins:

Methodological approach for studying this phenomenon:

  • Cellular stress induction techniques:

    • Pharmacological ER-to-Golgi transport inhibitors (Brefeldin A)

    • ER stress inducers (thapsigargin, tunicamycin)

    • Heat shock treatments

  • Protein trafficking visualization methods:

    • Live-cell imaging with fluorescently tagged cargo proteins

    • Temperature-sensitive cargo proteins (VSVG-ts045-GFP)

    • Surface biotinylation assays

    • Glycosylation pattern analysis (EndoH/PNGase F sensitivity)

  • Genetic manipulation approaches:

    • DNAJC14 knockout and rescue experiments

    • Mutant analysis (J-domain, C-terminal domain mutants)

    • siRNA screening of interacting partners

  • Biochemical interaction studies:

    • Co-immunoprecipitation with Hsc70/Hsp70 and cargo proteins

    • Proximity labeling approaches (BioID, APEX)

    • Subcellular fractionation and membrane preparation

Case study: DNAJC14's role in rescuing misfolded pendrin (H723R-pendrin)

  • Activation of ER stress induced Golgi-independent cell-surface expression of H723R-pendrin

  • DNAJC14 upregulation alone was sufficient to induce this unconventional trafficking

  • The process required interaction with Hsc70 and the J-domain of DNAJC14

  • This pathway restored functional activity of the misfolded protein at the cell surface

What are the critical determinants for DNAJC14 self-interaction and how can researchers experimentally assess them?

DNAJC14 self-interaction (dimerization) is mediated by its C-terminal domain and is critical for its function:

Experimental evidence:

  • Deletion of the C-terminal 77 amino acids abolishes self-interaction

  • Self-interaction correlates with antiviral activity against YFV

  • Mutants retaining the C-terminal domain but lacking other regions maintain self-interaction

Methods to assess DNAJC14 self-interaction:

  • Co-immunoprecipitation approaches:

    • Co-expression of differentially tagged DNAJC14 variants (e.g., GFP and myc tags)

    • Immunoprecipitation with one tag, detection with the other

    • Buffer conditions: 10 mM HEPES, pH 7.5, 150 mM KCl, 3 mM MgCl₂, 0.5% NP-40

  • Förster resonance energy transfer (FRET):

    • Expression of DNAJC14 fused to compatible FRET pairs

    • Live-cell measurements of protein-protein proximity

    • Analysis of dimerization dynamics in different cellular compartments

  • Size exclusion chromatography:

    • Analysis of purified recombinant protein

    • Detection of monomer-dimer equilibrium

    • Assessment of mutation effects on oligomerization state

  • Analytical ultracentrifugation:

    • Precise determination of molecular weight and stoichiometry

    • Analysis of concentration-dependent self-association

Protocol for co-immunoprecipitation assay:

  • Co-transfect cells with GFP-tagged and myc-tagged DNAJC14 constructs

  • Harvest cells and lyse in buffer containing 0.5% NP-40

  • Perform immunoprecipitation with anti-myc antibodies

  • Analyze precipitates by Western blot using anti-GFP antibodies

  • Perform reciprocal immunoprecipitation as control

How do mutations in the J-domain of DNAJC14 affect its diverse cellular functions?

The J-domain of DNAJC14 contains the conserved HPD motif critical for stimulating the ATPase activity of Hsp70 chaperones:

MutationEffect on J-domain FunctionImpact on Viral InhibitionEffect on Protein TraffickingResearch Applications
H471QAbolishes Hsp70 activationNo inhibition of YFVImpaired unconventional traffickingNegative control in viral studies
L466PDisrupts J-domain structureNo inhibition of YFVNot determinedNaturally occurring inactive variant
HPD→AAAComplete loss of functionNo viral inhibitionBlocked chaperone activityStudy of chaperone-independent functions

Experimental approaches to assess J-domain function:

  • ATPase assays with purified proteins:

    • Measurement of Hsp70 ATPase stimulation

    • Assessment of nucleotide exchange rates

    • Comparison of wild-type and mutant J-domains

  • Protein folding and trafficking assays:

    • Rescue of misfolded proteins (e.g., pendrin H723R)

    • Trafficking of model cargo proteins

    • ER stress responses in cells expressing mutants

  • Viral replication assays:

    • Complementation studies in DNAJC14 knockout cells

    • Assessment of viral protein processing and RNA replication

    • Localization studies with viral replication complexes

The J-domain mutations provide valuable research tools for dissecting the chaperone-dependent and independent functions of DNAJC14 in diverse cellular processes .

How can researchers effectively design and validate CRISPR/Cas9 knockout systems for DNAJC14 studies?

CRISPR/Cas9-mediated knockout of DNAJC14 has proven valuable for studying its function:

Step-by-step methodology:

  • gRNA design:

    • Target early exons to ensure complete functional knockout

    • Select guides with high on-target and low off-target scores

    • For bovine DNAJC14, target conserved regions in exons 2-4

    • Design multiple gRNAs to increase knockout efficiency

  • Delivery methods:

    • Lentiviral delivery for stable integration in difficult-to-transfect cells

    • Transient plasmid transfection for easily transfectable cells (HEK293T)

    • Ribonucleoprotein complexes for reduced off-target effects

  • Validation strategies:

    • Genomic verification: PCR and sequencing of target site

    • Protein verification: Western blot with validated antibodies

    • Functional verification: Infection with DNAJC14-dependent viruses

    • Complementation tests: Rescue with wild-type DNAJC14 expression

  • Common pitfalls and solutions:

    • Incomplete knockout: Use single-cell cloning and thorough validation

    • Off-target effects: Validate with multiple gRNA lines

    • Compensatory mechanisms: Analyze acute DNAJC14 depletion

    • Cell viability issues: Optimize for cell type-specific conditions

Example validation protocol:

  • Genomic DNA PCR and sequencing to confirm indel generation

  • Western blot using antibodies against different DNAJC14 epitopes

  • Challenge with noncp BVDV to confirm resistance

  • Complementation with wild-type DNAJC14 to restore viral susceptibility

What are the key considerations for designing recombinant truncated forms of bovine DNAJC14 for functional studies?

Truncated forms of bovine DNAJC14 are valuable tools for dissecting domain-specific functions:

Design considerations:

  • Functionally relevant fragments:

    • Jiv90 (aa 536-620): Minimal fragment for NS2 interaction

    • J-domain (aa 456-475): For Hsp70 interaction studies

    • NT5 (lacking all TM domains): Soluble form retaining inhibitory activity

    • CT1 (lacking C-terminal 77 aa): Non-inhibitory mutant for localization studies

  • Expression optimization:

    • Codon optimization for expression system

    • Addition of appropriate tags (N-terminal for full activity)

    • Inclusion of flexible linkers between domains

    • Signal sequences for proper localization

  • Functional validation approaches:

    • Viral replication assays to assess inhibitory activity

    • Protein-protein interaction studies (co-IP, pull-down)

    • Subcellular localization analysis

    • Complementation studies in knockout cells

Experimental data shows that the NT5 truncation mutant (lacking all TM domains) retains full inhibitory activity against YFV, while the CT1 mutant (lacking C-terminal self-interaction domain) loses inhibitory function but still localizes to viral replication complexes .

How can recombinant bovine DNAJC14 be utilized to develop attenuated viral vaccines?

The dual role of DNAJC14 in viral replication offers unique opportunities for vaccine development:

  • DNAJC14-based attenuation strategies:

    • Engineering viral genomes to include DNAJC14-independent NS3 release

    • Creating "synthetic" cytopathogenic viruses with controlled replication

    • Development of self-limiting viruses through DNAJC14 dependency modification

  • Proof-of-concept studies:

    • APPV genomes with duplicated NS3 sequences show increased replication without cytopathogenicity

    • Synthetic BVDV genomes with altered DNAJC14 dependency demonstrate attenuated phenotypes

    • Yellow fever virus mutants with modified NS2-3 processing show potential as attenuated vaccines

  • Methodological approach:

    • Viral genome engineering to modify NS2-3 cleavage sites

    • Insertion of Jiv90-coding sequences into viral genomes

    • Creation of replication-optimized synthetic viral genomes

    • Evaluation in DNAJC14 knockout and wild-type cells

  • Safety and efficacy considerations:

    • Genetic stability of attenuated strains

    • Balance between immunogenicity and attenuation

    • Prevention of reversion to virulence

    • Validation in relevant animal models

What methodological approaches can be used to identify alternative cellular cofactors for viral replication in DNAJC14-independent viruses like APPV?

The discovery that APPV replicates independently of DNAJC14 suggests the existence of alternative cellular cofactors:

Comprehensive identification strategy:

  • Comparative proteomics approach:

    • Viral protein (NS2) pulldown coupled with mass spectrometry

    • Comparison between DNAJC14-dependent and independent viruses

    • SILAC or TMT labeling for quantitative comparison

    • Focus on chaperone and co-chaperone proteins

  • Genome-wide CRISPR screening:

    • APPV-specific cell death or reporter assays

    • Screening in DNAJC14 knockout background

    • Secondary validation with individual gene knockouts

    • Comparison with screens for classical pestiviruses

  • Candidate-based approaches:

    • Testing of other DNAJ family members

    • Evaluation of alternative Hsp70 co-chaperones

    • Assessment of ER-resident folding factors

    • Focus on proteins with J-domain-like functionality

  • Structural biology approaches:

    • Cryo-EM analysis of APPV NS2-3 processing complexes

    • Hydrogen-deuterium exchange mass spectrometry

    • Cross-linking mass spectrometry to identify interaction partners

    • Computational prediction of potential binding partners based on structural homology

Validation methodology:

  • Knockout/knockdown of candidate cofactors

  • Biochemical validation of direct interactions

  • Complementation studies with recombinant proteins

  • Assessment of NS2-3 cleavage efficiency in reconstituted systems

How can proteomic approaches be optimized to identify the complete interactome of recombinant bovine DNAJC14?

Comprehensive interactome analysis of bovine DNAJC14 requires specialized proteomic approaches:

  • Proximity-based labeling methods:

    • BioID fusion to DNAJC14 for biotinylation of proximal proteins

    • APEX2 fusion for peroxidase-based proximity labeling

    • Split-BioID for interaction-dependent labeling

    • TurboID for rapid labeling of transient interactions

  • Affinity purification optimizations:

    • Crosslinking approaches to capture transient interactions

    • Membrane-specific solubilization methods (digitonin, CHAPSO)

    • Sequential purification with different detergents

    • Comparative analysis of different cellular compartments

  • Mass spectrometry considerations:

    • Sample preparation for membrane protein complexes

    • SILAC or TMT labeling for quantitative comparison

    • Data-independent acquisition for improved coverage

    • Ion mobility separation for complex samples

  • Bioinformatic analysis pipeline:

    • Filtering against appropriate control datasets

    • Network analysis to identify functional clusters

    • Integration with publicly available interactome data

    • Gene ontology enrichment analysis

Experimental design recommendations:

  • Include multiple DNAJC14 constructs (full-length, truncations)

  • Compare interactions under different cellular conditions (ER stress, viral infection)

  • Validate key interactions through reciprocal pulldowns

  • Confirm functional relevance through genetic perturbation

What are the methodological approaches for investigating the role of DNAJC14 post-translational modifications in regulating its function?

Post-translational modifications (PTMs) potentially regulate DNAJC14 function, though this area remains largely unexplored:

Comprehensive PTM analysis strategy:

  • Identification methods:

    • High-resolution mass spectrometry of purified DNAJC14

    • Enrichment strategies for specific modifications (phosphopeptides, ubiquitylated peptides)

    • Targeted MS/MS approaches for predicted modification sites

    • PTM-specific antibodies for Western blot validation

  • Site-directed mutagenesis approach:

    • Mutation of identified PTM sites to non-modifiable residues

    • Phosphomimetic mutations (S/T→D/E)

    • Generation of lysine-to-arginine mutants for ubiquitylation sites

    • Creation of comprehensive PTM-null mutants

  • Functional impact assessment:

    • Viral replication assays with PTM mutants

    • Protein-protein interaction studies focusing on J-domain partners

    • Trafficking and localization analysis

    • Protein stability and turnover measurements

  • PTM regulation studies:

    • Identification of responsible kinases/phosphatases

    • Characterization of E3 ligases targeting DNAJC14

    • Analysis of PTM changes during viral infection

    • Investigation of PTM crosstalk

Experimental workflow:

  • Purify recombinant bovine DNAJC14 from appropriate expression system

  • Perform comprehensive PTM mapping by mass spectrometry

  • Generate site-directed mutants of key PTM sites

  • Assess functional consequences in relevant assay systems

  • Identify enzymes responsible for adding/removing modifications

  • Investigate regulation of PTMs under different cellular conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.