Recombinant Bovine DnaJ homolog subfamily C member 18 (DNAJC18)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine DnaJ Homolog Subfamily C Member 18 (DNAJC18)

DnaJ homolog subfamily C member 18 (DNAJC18) is a protein that, in humans, is encoded by the DNAJC18 gene . DNAJC18 belongs to the DnaJ/Hsp40 family of proteins, which are known to function as co-chaperones with Hsp70 proteins, participating in a variety of cellular processes such as protein folding, protein trafficking, and stress responses .

Gene and Protein Characteristics

DnaJC18 gene encodes a type III DnaJ family protein . The full-length DnaJC18 cDNA has an open reading frame of 357 amino acids . DnaJC18 protein has a molecular weight of approximately 41.2 kDa .

Expression and Localization

  • Tissue Specificity DnaJC18 gene exhibits specific expression patterns in certain tissues . Studies in rats have shown that DnaJC18 is predominantly expressed in the testis, specifically during the maturation stages of late pachytene, round, and elongated spermatids .

  • Cellular Localization Cellular localization studies have indicated that DnaJC18 protein is found in the cytoplasm of cells .

Functional Significance

  • Role in Spermatogenesis Research suggests that DnaJC18 may play a role in germ cell maturation during spermatogenesis .

  • Cardiac Function DNAJC18 is important for cardiac homeostasis, and its loss of function is associated with altered left ventricular systolic function .

Association with Cardiac Disease

Studies have identified a link between the DNAJC18 gene and cardiac function . Loss-of-function mutations in DNAJC18 have been associated with altered left ventricular systolic function, suggesting its importance in maintaining cardiac homeostasis .

Interactions with Other Molecules

DNAJC18 interacts with various compounds, which can affect its expression .

Table 1: Examples of compounds affecting DNAJC18 expression

CompoundEffect on Expression
bisphenol SDecreased
acetamideDecreased
Aflatoxin B1Decreased
Antirheumatic AgentsIncreased
CisplatinIncreased
DDEDecreased
Folic AcidIncreased
FuranIncreased
Sodium arseniteDecreased/Increased
VorinostatDecreased

Role in Congenital Heart Disease

Research has indicated the potential involvement of DNAJC18 in congenital heart disease . Studies using single-gene-null mouse lines have identified Dnajc18 as one of the genes associated with developmental cardiac structural abnormalities .

Genetic Variations and Disease

Genetic variants in DNAJC18 have been identified in association with congenital heart disease . The study of these variants may provide insights into the genetic mechanisms underlying cardiac disorders .

Implications for Mouse-to-Human Translation

The association between DNAJC18 loss of function and altered left ventricular systolic function has been confirmed through mouse-human alignment with left ventricular image-derived phenotypes from the UK Biobank .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. To ensure your preferred tag type is used, please specify your requirements at the time of ordering; we will prioritize fulfilling those requests.
Synonyms
DNAJC18; DnaJ homolog subfamily C member 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-358
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
DNAJC18
Target Protein Sequence
MAATLGSGERWTEAYIDAVRRNKYPEDRPPESHDPCGCCNCMKGQKEKKSENEWSQTRQG EGNSTYTEEQLLGVQRIKKCRNYYEILGVSRDASDEELKKAYRKLALKFHPDKNCAPGAT DAFKAIGNAFAVLSNPDKRLRYDEYGDEQVTFTAPRARPYNYYRDFETDITPEELFNVFF GGHFPTGNIHMFSNVTDDTHYYRRRHRHERMQTRKEEEEDKPQTTYSAFIQLLPVLVIVI ISVITQLLAANPPYSLFYKSTLGHTISRETQNLQVPYFVDKNFDKAYRGASLRDLEKTIE KDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is DNAJC18 and what is its functional significance?

DNAJC18 belongs to the type III DnaJ family of proteins, characterized by having a J-domain but lacking both the zinc finger and G/F-rich regions found in type I DnaJ proteins. The full-length DNAJC18 cDNA encodes a protein of approximately 357 amino acids with a molecular weight of approximately 41.2 kDa .

Studies in mammalian models indicate that DNAJC18 is predominantly expressed in testicular tissue, specifically during the maturation stages of spermatogenesis, including late pachytene, round, and elongated spermatids . This tissue-specific expression pattern suggests a specialized role in germ cell development and maturation rather than a generalized cellular function.

Subcellular localization studies using GFP-tagged DNAJC18 have demonstrated that the protein is primarily localized in the cytoplasm of cells, which provides important insights into its potential functional interactions and molecular pathways .

How is DNAJC18 expressed in different mammalian tissues?

DNAJC18 shows a highly tissue-specific expression pattern. According to detailed Northern blot analyses, DNAJC18 gene expression is predominantly detected in testicular tissue . Developmentally, expression begins at approximately postnatal week 4 in rat testis, coinciding with the onset of spermatogenesis .

In situ hybridization studies have further refined our understanding of DNAJC18 expression, demonstrating that the mRNA is specifically expressed during the maturation stages of spermatogenesis, particularly in late pachytene spermatocytes, round spermatids, and elongated spermatids in adult rat testis . This temporal expression pattern provides strong evidence for DNAJC18's role in germ cell maturation.

Western blot analysis with specific antibodies has confirmed that the 41.2 kDa DNAJC18 protein is detected only in adult testis, corroborating the mRNA expression data .

What are the recommended methods for detecting DNAJC18?

Multiple complementary approaches can be employed for reliable detection of DNAJC18 in research samples:

  • Northern Blot Analysis: Effective for tissue-specific and developmental expression studies of DNAJC18 mRNA .

  • In Situ Hybridization: Provides spatial resolution of DNAJC18 mRNA expression within specific cell types in tissue sections, particularly valuable for reproductive tissue studies .

  • Western Blot Analysis: Using specific antibodies against DNAJC18 allows for protein detection and quantification. This method has successfully detected the 41.2 kDa protein in testicular samples .

  • Immunohistochemistry: Enables visualization of DNAJC18 protein distribution within tissue sections, confirming expression in developing germ cells .

  • Fluorescence Microscopy with Tagged Proteins: Confocal microscopy with GFP-tagged DNAJC18 has been used to determine subcellular localization (cytoplasmic) .

For experiments requiring quantitative analysis of gene expression changes, normalization of data using appropriate reference genes is essential for reliable results .

How is recombinant DNAJC18 typically produced for research applications?

Recombinant DNAJC18 can be produced using several expression systems, each with distinct advantages depending on research requirements:

Expression Systems for DNAJC18 Production:

Host SystemTag OptionsAdvantagesCommon Applications
HEK-293 CellsHis tag, Strep tagMammalian post-translational modifications, >90% purity achievableProtein-protein interaction studies, structural analysis
Cell-free protein synthesis (CFPS)Strep tagRapid production, avoids cellular toxicity issuesPreliminary functional assays, 70-80% purity typically achieved
Wheat germHis tagPlant-based alternative, good for potentially toxic proteinsELISA, Western blotting, activity assays

The recombinant DNAJC18 protein sequence typically includes all 357 amino acids of the native protein. For mouse DNAJC18, the amino acid sequence begins with MATTLGSGER and contains multiple conserved domains characteristic of type III DnaJ proteins .

Purification is commonly achieved through affinity chromatography targeting the fusion tag (His or Strep), followed by quality control assessment using techniques such as SDS-PAGE, Western blot, and analytical size exclusion chromatography (SEC) to verify protein integrity and purity .

What chemical compounds and environmental factors affect DNAJC18 expression?

Research has identified various compounds that modulate DNAJC18 expression or methylation status. This information is valuable when designing experiments that may be confounded by exposure to these agents or when investigating regulatory mechanisms.

Compounds Affecting DNAJC18 Expression:

CompoundEffect on DNAJC18Model SystemPotential Research Applications
1,2-dimethylhydrazineIncreases expressionRat/MouseCarcinogenesis studies
17α-ethynylestradiolIncreases expressionRatEndocrine disruption research
1H-pyrazoleIncreases expressionMouseMetabolic studies
2,3,7,8-tetrachlorodibenzodioxineAffects expressionMouseEnvironmental toxicology
2-methoxyethanolIncreases expressionRatReproductive toxicology
4,4'-sulfonyldiphenol (bisphenol S)Decreases expressionMouseEndocrine disruption studies
4,4'-sulfonyldiphenolIncreases methylationHumanEpigenetic regulation research
AcetamideDecreases expressionRatToxicology studies
Aflatoxin B1Decreases methylationHumanCarcinogenesis models

These findings suggest that DNAJC18 expression is responsive to various environmental toxins and endocrine-disrupting compounds, making it a potential biomarker for exposure studies. Researchers should consider these effects when interpreting expression data from samples with potential exposure to these compounds.

What approaches are recommended for studying DNAJC18 function in reproductive biology?

Given DNAJC18's tissue-specific expression pattern in testicular tissue, several methodological approaches are particularly well-suited for investigating its function in reproductive biology:

  • Developmental Expression Analysis: Monitoring DNAJC18 expression across different developmental stages of spermatogenesis can provide insights into its temporal function. Northern blot analysis starting from early postnatal periods (week 1) through adulthood can establish expression patterns correlated with specific developmental events .

  • Cell-Type Specific Localization: Combined in situ hybridization and immunohistochemistry approaches allow precise localization of DNAJC18 within specific cell populations in the seminiferous tubules. This approach has successfully demonstrated expression in late pachytene spermatocytes, round spermatids, and elongated spermatids .

  • Subcellular Fractionation Coupled with Immunoblotting: This approach can further refine our understanding of DNAJC18's precise localization within the cytoplasmic compartment, potentially identifying association with specific organelles or cytoskeletal elements.

  • Co-Immunoprecipitation Studies: Identifying protein interaction partners is crucial for understanding DNAJC18's molecular function. As a DnaJ protein family member, DNAJC18 likely interacts with Hsp70 chaperones and client proteins involved in spermatogenesis.

  • Conditional Knockout Models: Given the testis-specific expression, generating conditional knockout models using Cre-lox systems with germline-specific promoters can help evaluate the phenotypic consequences of DNAJC18 deficiency while avoiding potential developmental lethality.

What are the recommended approaches for analyzing DNAJC18 expression data?

When analyzing DNAJC18 expression data across experimental conditions, several key analytical steps should be followed:

  • Quality Control Assessment: Before analyzing expression data, researchers should verify that samples meet quality control metrics for the chosen detection platform. For digital counting methods (like NanoString), this includes checking positive and negative control performance .

  • Background Correction: To minimize technical noise, appropriate background subtraction should be performed. This typically involves subtracting signal from negative controls or using more sophisticated approaches for complex platforms .

  • Normalization Strategies: Due to DNAJC18's tissue-specific expression pattern, normalization strategy selection is particularly important:

    • For comparisons within testicular tissue, housekeeping genes with stable expression during spermatogenesis should be selected

    • For cross-tissue comparisons, normalization to total RNA may be more appropriate than using housekeeping genes that may vary across tissues

  • Ratio and Fold-Change Calculations: When comparing DNAJC18 expression between experimental groups, consistent methods for calculating ratios and fold-changes should be employed. Log2 transformation of ratios is recommended for statistical analyses to normalize distribution characteristics .

  • Statistical Analysis for Differential Expression: For experiments with biological replicates, appropriate statistical tests should be applied to determine significant differences in expression. Multiple testing correction methods (e.g., Benjamini-Hochberg) should be implemented to control false discovery rates in multi-gene studies that include DNAJC18 .

How can researchers address contradictory findings regarding DNAJC18 function?

When confronted with contradictory findings regarding DNAJC18 function or expression patterns, researchers should systematically evaluate several factors that might explain the discrepancies:

  • Species-Specific Differences: Current research indicates differences in DNAJC18 function across mammalian species. While testis-specific expression has been documented in rats , expression patterns may differ in other species. Therefore, researchers should clearly specify the model organism and avoid cross-species extrapolation without validation.

  • Developmental Timing: DNAJC18 expression is developmentally regulated, beginning at approximately postnatal week 4 in rats . Contradictory findings may result from comparing tissues at different developmental stages. Detailed documentation of specimen age and developmental stage is critical.

  • Antibody Specificity: For protein-level studies, differences in antibody specificity can lead to conflicting results. Researchers should validate antibodies using appropriate controls, including recombinant protein standards and samples from knockout models when available.

  • Environmental Exposures: Given that multiple compounds affect DNAJC18 expression , undocumented exposures to these agents could explain contradictory findings. Detailed reporting of housing conditions, diet, and environmental factors is recommended.

  • Technical Approach Limitations: Different detection methods have varying sensitivity and specificity profiles. Verification of key findings using complementary techniques (e.g., confirming RNA-seq results with qPCR) can help resolve contradictions arising from methodological differences.

What controls should be included when studying recombinant DNAJC18?

When working with recombinant DNAJC18, appropriate controls are essential for experimental validity:

  • Tag-Only Controls: Since recombinant DNAJC18 is typically produced with fusion tags (His or Strep) , control proteins containing only the tag should be included to distinguish tag-mediated effects from DNAJC18-specific functions.

  • Inactive Mutant Controls: For functional studies, researchers should consider generating point mutations in key functional domains (particularly the J-domain) to create catalytically inactive DNAJC18 controls.

  • Specificity Controls for Antibodies: When using antibodies against recombinant DNAJC18, pre-absorption with the immunizing peptide or recombinant protein can verify specificity and minimize non-specific binding.

  • Endogenous Expression Verification: For studies in cell lines or tissues, confirming endogenous DNAJC18 expression levels (or lack thereof) is important for interpreting overexpression or knockdown studies.

  • Expression System Controls: When comparing recombinant DNAJC18 produced in different expression systems (HEK-293 versus cell-free) , researchers should account for potential differences in post-translational modifications that may affect protein function.

What are promising directions for advancing DNAJC18 research?

Based on current knowledge and technological capabilities, several research directions hold particular promise for advancing our understanding of DNAJC18:

  • Proteomics-Based Identification of Interaction Partners: Comprehensive identification of DNAJC18 client proteins and cofactors would significantly enhance our understanding of its functional role. Techniques such as BioID or proximity labeling could reveal the DNAJC18 interaction network in testicular cells.

  • Structural Biology Approaches: Determining the three-dimensional structure of DNAJC18 would provide insights into its molecular mechanism. Cryo-EM or X-ray crystallography of recombinant DNAJC18 could reveal unique structural features distinguishing it from other DnaJ proteins.

  • Single-Cell Transcriptomics: Applying single-cell RNA sequencing to different stages of spermatogenesis could provide higher resolution data on DNAJC18 expression patterns and co-expressed genes, potentially revealing functional networks.

  • Genome-Wide Association Studies: Investigating potential associations between DNAJC18 polymorphisms and male fertility parameters could establish clinical relevance and guide translational research.

  • CRISPR-Based Functional Genomics: Systematic interrogation of DNAJC18 domains through precise gene editing could map functional regions and their contribution to spermatogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.