Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for customer use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RPN2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-631
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
LTPTHYLTKHDVERLKASLDRPFTSLESAFYSIVGLSSLGAQVPDVKKACTFIKSNLDPS NVDSLFYAAQSSQALSGCEISISNETKDLLLAAVSEDSSVAQIYHAVAALSGFGLPLASQ EALGALTARLSKEETVLATVQALQTASYLSQQADLRSIVEEIEDLVARLDELGGVYLQFE EGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASAAAAL SENRYHVPVVVVPEGSPSYTQEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQK TSFTLIGDVFELNFMNVKFSSGYYDFSVKVEGDNRYIANTVELRVKISTEVGITNVDLST VDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQK TGQEVVFVAEPDSKNVYKFELDTSERKLEFDSASGTYTLYLIIGDATLKNPILWNVADVV IRFPEDDVPSTVLSKNIFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIR IGANVSNFTFAPSTIVFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLA QQAIKRTAH
Uniprot No.

Target Background

Function

Recombinant Bovine Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2) is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation, a cotranslational process. The OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER) membrane. All subunits are essential for optimal enzyme activity.

Database Links
Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of RPN2?

RPN2 (Ribophorin II) is a highly conserved glycoprotein located in rough endoplasmic reticulum (RER) membranes. It serves as an essential component of the oligosaccharyltransferase complex responsible for the N-glycosylation of numerous proteins . The protein mediates the translocation of secretory proteins and helps maintain endoplasmic reticulum specificity . It functions primarily in the initial transfer of defined glycans from lipid carriers to asparagine residues within specific consensus motifs (Asn-X-Ser/Thr) in nascent polypeptide chains .

How does bovine RPN2 differ from human RPN2 in terms of structure and function?

While both bovine and human RPN2 serve similar fundamental functions within the oligosaccharyltransferase complex, they exhibit species-specific sequence variations that may affect antibody recognition, substrate binding efficiency, and post-translational modifications. Comparative analysis shows conservation of the core functional domains responsible for N-glycosylation activity, while differences primarily occur in non-catalytic regions. These variations should be considered when transferring research findings between species or when using bovine models for human disease research.

What protein complexes does RPN2 participate in and what are its binding partners?

RPN2 functions as a component of the oligosaccharyltransferase (OST) complex. According to protein-protein interaction data, RPN2 interacts with multiple proteins including RPN1, STT3A/B, and MAGT1, which are associated with tumor progression in various cancers . The OST complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum . RPN2 is required for the assembly of both SST3A- and SS3B-containing OST complexes .

How is RPN2 expression regulated in normal tissues versus disease states?

In normal tissues, RPN2 expression is tightly regulated to maintain proper protein N-glycosylation. In disease states, particularly cancer, RPN2 is frequently upregulated. Research demonstrates that RPN2 is aberrantly expressed in bladder cancer tissues compared to adjacent normal tissues . Similar upregulation has been observed in breast, gastric, and colorectal cancers . This differential expression pattern makes RPN2 a potential biomarker for disease progression. The mechanisms controlling this upregulation involve transcriptional regulation and may be linked to PI3K-Akt pathway activation in cancer cells .

What techniques are most effective for monitoring RPN2 expression in tissue samples?

Based on research protocols, several techniques have proven effective for monitoring RPN2 expression:

  • Quantitative Real-Time PCR (qRT-PCR): Using primers such as forward 5'-TGCCGAGCCAGACAACAAGAA-3' and reverse 5'-AGTAGAGAGTGTAGGTGCCAGAGG-3', with GAPDH as an internal control .

  • Immunohistochemistry (IHC): Paraffin-embedded sections (4 μm) should be processed with antigen retrieval in 10 nM citrate buffer (pH 6.0), followed by incubation with primary antibody against RPN2 (1:100 dilution) overnight at 4°C .

  • Western blotting: For protein-level quantification in both tissue samples and cell lines .

  • Bioinformatic analysis: Using databases such as UALCAN, GEPIA, and TCGA to analyze expression patterns across different cancer types and stages .

What are the optimal expression systems for producing recombinant bovine RPN2?

For recombinant bovine RPN2 production, several expression systems can be employed with varying advantages:

  • Mammalian expression systems (HEK293 or CHO cells): Provide proper post-translational modifications and folding, crucial for functional studies.

  • Insect cell systems (Sf9 or Hi5): Offer a balance between proper eukaryotic processing and higher yield compared to mammalian systems.

  • Bacterial systems (E. coli): While yielding higher protein quantities, they lack proper glycosylation machinery and may require refolding protocols.

The optimal choice depends on the research purpose: for structural studies, bacterial or insect cell systems may be sufficient, while functional studies typically require mammalian expression systems to maintain physiologically relevant modifications.

What purification challenges are specific to recombinant bovine RPN2 and how can they be overcome?

Recombinant bovine RPN2 purification presents several challenges:

  • Membrane association: As an ER membrane-associated protein, RPN2 requires detergent-based extraction methods. Optimization of detergent type (e.g., DDM, CHAPS) and concentration is critical.

  • Maintaining complex integrity: Since RPN2 functions within a complex, co-expression with other OST components may be necessary for proper folding and function.

  • Glycosylation heterogeneity: Variability in glycosylation patterns can affect purification profiles. Using glycosidase treatments or expressing in glycosylation-modified cell lines can provide more homogeneous preparations.

  • Protein stability: Adding stabilizing agents such as glycerol (10%) and reducing agents in buffers helps maintain protein integrity during purification and storage.

How can recombinant bovine RPN2 be used to study N-glycosylation pathways?

Recombinant bovine RPN2 serves as a valuable tool for studying N-glycosylation pathways through several approaches:

  • In vitro glycosylation assays: Purified recombinant RPN2, when reconstituted with other OST components, can be used to study substrate specificity and kinetics of glycan transfer.

  • Structural studies: Recombinant protein facilitates crystallography or cryo-EM studies to determine the molecular mechanisms of substrate recognition and catalysis.

  • Interaction studies: Labeled recombinant RPN2 can identify novel binding partners within the glycosylation machinery using pull-down assays or proximity labeling approaches.

  • Mutagenesis studies: Systematic mutation of conserved residues in recombinant RPN2 helps identify critical functional domains for N-glycosylation activity.

What role does RPN2 play in cancer progression and how can this be studied using recombinant protein?

RPN2 has been implicated in promoting cancer progression through several mechanisms. Studies show that RPN2 is highly expressed in various cancers including bladder cancer, and its expression correlates with tumor stage, lymph node metastasis, and pathological differentiation . RPN2 silencing inhibits cancer cell growth and metastasis both in vitro and in vivo .

Mechanisms of RPN2's oncogenic function include:

  • Regulation of epithelial-mesenchymal transition (EMT)

  • Activation of the PI3K-Akt signaling pathway

  • Modulation of cell cycle proteins like cyclinD1 and pro-apoptotic protein Bax

  • Conferring drug resistance through glycosylation of proteins such as multidrug resistance protein 1 (MDR1)

Recombinant RPN2 can be used to study these mechanisms through:

  • In vitro glycosylation assays to identify cancer-specific substrates

  • Protein-protein interaction studies to map oncogenic signaling networks

  • Structural analysis to design inhibitors targeting RPN2-mediated glycosylation

What are the most effective knockdown strategies for studying RPN2 function?

Based on published research, effective RPN2 knockdown strategies include:

  • siRNA transfection: RPN2-specific siRNAs transfected using lipid-based reagents like Lipofectamine™ 3000 have shown high efficiency in reducing RPN2 expression . This approach is effective for short-term studies.

  • shRNA stable expression: For long-term studies, including in vivo experiments, lentiviral or retroviral delivery of shRNA against RPN2 provides sustained knockdown.

  • CRISPR-Cas9 gene editing: For complete knockout studies, CRISPR-Cas9 targeting of the RPN2 locus has proven effective in generating cellular models with permanent loss of RPN2 expression.

Validation of knockdown efficiency should be performed using both qRT-PCR and Western blotting to confirm reduction at both mRNA and protein levels .

What phenotypic assays are most informative when studying RPN2 function in cellular models?

When studying RPN2 function, the following phenotypic assays provide valuable insights:

  • Cell proliferation assays: MTT or BrdU incorporation assays reveal RPN2's impact on growth rates.

  • Migration and invasion assays: Transwell and wound healing assays demonstrate effects on metastatic potential .

  • Apoptosis analysis: Flow cytometry with Annexin V/PI staining detects changes in cell survival pathways .

  • Glycoprotein analysis: Lectin blotting or mass spectrometry to assess alterations in global protein glycosylation patterns.

  • Drug sensitivity testing: Dose-response curves for chemotherapeutic agents to evaluate RPN2's role in drug resistance .

  • In vivo tumor models: Xenograft studies in nude mice to confirm in vitro findings in a physiological context .

How do post-translational modifications affect RPN2 function and stability?

Post-translational modifications (PTMs) of RPN2 play crucial roles in regulating its function, stability, and interactions. Key PTMs include:

  • N-glycosylation: RPN2 itself undergoes N-glycosylation, which affects its folding, stability, and incorporation into the OST complex.

  • Phosphorylation: Phosphorylation sites, particularly on serine/threonine residues, regulate RPN2's activity and interactions with other proteins in response to cellular signaling.

  • Ubiquitination: Controls RPN2 turnover and degradation, affecting its cellular half-life and abundance.

Research techniques to study these modifications include mass spectrometry-based proteomics, site-directed mutagenesis of modification sites, and phospho-specific antibodies. Understanding these modifications provides insights into how RPN2 function is regulated in different physiological and pathological contexts.

How does the bovine RPN2 glycosylation machinery differ from other species, and what are the implications for using bovine RPN2 as a research model?

Bovine RPN2 glycosylation machinery shares significant homology with human systems but exhibits species-specific differences that researchers should consider:

  • Glycan composition: Bovine RPN2-mediated glycosylation may produce slightly different glycan structures compared to human systems, particularly in terminal modifications.

  • Substrate recognition: While the core Asn-X-Ser/Thr motif is conserved, subtle differences in the surrounding sequence preferences may exist between bovine and human RPN2.

  • Regulatory mechanisms: Cellular pathways regulating RPN2 expression and activity may differ between species.

These differences suggest that while bovine RPN2 serves as an excellent model for basic mechanistic studies of N-glycosylation, caution is needed when extrapolating findings to human disease contexts. Comparative glycoproteomics between bovine and human systems can help identify conserved and divergent aspects of RPN2 function.

What is the evidence for RPN2 as a prognostic biomarker in cancer?

Substantial evidence supports RPN2 as a prognostic biomarker in multiple cancer types:

This evidence suggests that RPN2 expression analysis could be incorporated into prognostic models to improve risk stratification for cancer patients.

How is RPN2 involved in drug resistance mechanisms and what approaches can overcome this resistance?

RPN2 contributes to drug resistance through several mechanisms:

  • Glycosylation of drug transporters: RPN2 mediates the glycosylation of multidrug resistance protein 1 (MDR1), affecting its membrane localization and drug efflux capacity .

  • PI3K-Akt pathway activation: RPN2 activates this pro-survival pathway, reducing the effectiveness of apoptosis-inducing therapies .

  • EMT promotion: By facilitating EMT, RPN2 contributes to a more aggressive and therapy-resistant phenotype .

Strategies to overcome RPN2-mediated resistance include:

  • RNAi-based therapies: siRNA or shRNA targeting RPN2 can sensitize resistant cancer cells to chemotherapy .

  • Glycosylation inhibitors: Compounds that inhibit specific steps in the N-glycosylation pathway may reduce RPN2's effect on drug resistance.

  • Combination therapies: PI3K-Akt pathway inhibitors combined with conventional chemotherapy may overcome resistance in RPN2-overexpressing tumors .

What novel techniques are emerging for studying RPN2 function in complex biological systems?

Emerging technologies are revolutionizing RPN2 research:

  • Single-cell glycoproteomics: Allows analysis of RPN2-mediated glycosylation heterogeneity within tissues and tumors.

  • Proximity labeling methods (BioID, APEX): Identify dynamic RPN2 interaction networks in living cells.

  • Cryo-electron microscopy: Provides structural insights into RPN2 within the intact OST complex.

  • CRISPR-based screens: Identify synthetic lethal interactions with RPN2 for developing targeted therapies.

  • Glycoprotein-specific imaging probes: Monitor RPN2 activity in real-time within living systems.

  • Patient-derived organoids: Test RPN2-targeting strategies in more physiologically relevant models.

These approaches will deepen our understanding of RPN2 biology and accelerate the development of targeted interventions for RPN2-related diseases.

What are the current challenges in translating RPN2 research findings to clinical applications?

Despite promising research findings, several challenges exist in translating RPN2 research to clinical applications:

  • Target specificity: Developing interventions that specifically target RPN2 without disrupting other essential glycosylation processes remains challenging.

  • Delivery systems: Efficiently delivering RPN2-targeting therapeutics (such as siRNAs) to specific tissues presents technical hurdles.

  • Biomarker standardization: Establishing standardized protocols for measuring RPN2 as a clinical biomarker requires further validation across multiple institutions.

  • Functional redundancy: Potential compensatory mechanisms in the glycosylation machinery may limit the effectiveness of RPN2-targeting approaches.

  • Model systems limitations: Differences between experimental models and human disease may complicate the translation of preclinical findings.

Addressing these challenges requires collaborative efforts between basic scientists, clinicians, and pharmaceutical researchers to bridge the gap between laboratory discoveries and clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.