Recombinant Bovine Duffy antigen/chemokine receptor (DARC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the product is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ACKR1; DARC; FY; Atypical chemokine receptor 1; Duffy antigen/chemokine receptor; CD antigen CD234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGNCLYPVADDNSTKLAIKEDFLIDFPEDYYPDYNETDVEAAAPCHSCSLLNYSSLPFFI LVSILGILASGTILYALLRPLFRWQLYQDRSTLVQLAVGSALFSIVVPILARGLSGALIT SLCHLAHLVAYGSAFAQALLIGYHACLGPQLGAGQVPGLRLGVTVGLWGVAALLSLPVVL GSDTSQGLCTVTFSGEWETLRYIHAAACFAIFVLLPLGLLGTKGLKTVLGRAPCPWVDVL WVWFIFWWPQGMTLGLDSLVRSKAIVVSTCPAQQALDMLLDVAEALAILHCVATPLLLAW VCYQATHTSPPSLPLPTTQTSHLDTLGGKS
Uniprot No.

Target Background

Function
The Duffy antigen/chemokine receptor (DARC) is an atypical chemokine receptor that regulates chemokine levels and localization. It binds chemokines with high affinity, but this interaction does not trigger classic ligand-driven signal transduction cascades. Instead, it leads to chemokine sequestration, degradation, or transcytosis. DARC is also known as interceptor (internalizing receptor), chemokine-scavenging receptor, or chemokine decoy receptor. It exhibits a promiscuous chemokine-binding profile, interacting with inflammatory chemokines from both the CXC and CC subfamilies, but not with homeostatic chemokines. DARC acts as a receptor for chemokines including CCL2, CCL5, CCL7, CCL11, CCL13, CCL14, CCL17, CXCL5, CXCL6, IL8/CXCL8, CXCL11, GRO, RANTES, MCP-1, and TARC. It may regulate chemokine bioavailability and, consequently, leukocyte recruitment through two distinct mechanisms: when expressed in endothelial cells, it facilitates the abluminal to luminal transcytosis of tissue-derived chemokines, allowing their presentation to circulating leukocytes; when expressed in erythrocytes, it acts as a blood reservoir for cognate chemokines but also as a chemokine sink, buffering potential surges in plasma chemokine levels.
Gene References Into Functions
  1. the 5' flanking region of the DARC gene was isolated and characterized PMID: 19559488
Database Links
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Subcellular Location
Early endosome. Recycling endosome. Membrane; Multi-pass membrane protein.

Q&A

How does Bovine DARC differ from other conventional chemokine receptors?

Unlike conventional chemokine receptors, Bovine DARC does not exhibit productive G protein-coupling as measured by second messenger responses such as calcium release. This lack of signaling capability is due to the dramatic shortening of TM5 and TM6 on the intracellular side, which precludes the coupling of canonical signal-transducers including G proteins, GRKs, and β-arrestins. Additionally, unlike prototypical GPCRs and β-arrestin-biased atypical chemokine receptors, DARC appears to lack β-arrestin binding completely. This functional divergence has been confirmed through extensive cellular assays, establishing DARC as an enigmatic seven-transmembrane receptor with unique properties. These structural differences contribute to DARC's primary function as a chemokine scavenger rather than a signaling receptor .

What tissue distribution patterns are observed for Bovine DARC?

Based on current research findings, DARC expression patterns are relatively conserved across species. While initially identified on red blood cells and used to classify the Duffy blood group system, DARC has been found to be expressed by multiple cell types including epithelial cells of lung and kidney, endothelial cells of capillaries, hair cells of cochlea, airway smooth muscle cells, and selected regions of the brain. This diverse tissue distribution suggests multiple physiological roles beyond chemokine scavenging, potentially including tissue-specific functions that vary based on local microenvironments. Understanding these expression patterns is crucial for designing targeted research approaches and interpreting experimental results in the context of specific tissue environments .

What is the chemokine binding profile of Bovine DARC?

Bovine DARC exhibits promiscuous binding to multiple chemokines, particularly those of the C-C and C-X-C types. This broad binding profile distinguishes it from conventional chemokine receptors that typically demonstrate more selective ligand recognition. Structural studies using cryo-EM have revealed that DARC employs a relatively superficial binding mode with chemokines like CCL7, with the N-terminus of the receptor serving as the primary interaction interface. The partially formed orthosteric binding pocket lacks the second site for chemokine recognition that is typically present in conventional chemokine receptors. This structural arrangement allows DARC to function effectively as a chemokine scavenger despite its inability to initiate downstream signaling. Researchers investigating the binding kinetics of DARC should consider employing techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) to uncover ligand-induced structural changes in the receptor, which can provide insights into the promiscuous nature of chemokine binding .

Why does Bovine DARC fail to exhibit canonical signaling responses?

Bovine DARC's inability to initiate canonical signaling responses stems from its unique structural features, particularly the dramatic shortening of transmembrane domains TM5 and TM6 on the intracellular side. This structural characteristic prevents the formation of the intracellular binding pocket required for G protein coupling. Additionally, this structural arrangement precludes the recruitment of G protein-related kinases (GRKs) and β-arrestins, which are essential for conventional GPCR signaling and regulation. Extensive cellular assays have confirmed this lack of signaling capability. Researchers investigating DARC signaling should employ multiple complementary approaches, including calcium flux assays, β-arrestin recruitment assays, and phosphorylation studies, to comprehensively characterize its non-canonical properties. This signaling deficiency contributes to DARC's primary function as a chemokine scavenger rather than a signal-transducing receptor .

How does the scavenging function of Bovine DARC impact experimental design?

When designing experiments to study Bovine DARC's scavenging function, researchers must consider its ability to bind and internalize chemokines without initiating conventional signaling cascades. This requires specialized experimental approaches distinct from those used for studying signaling chemokine receptors. Techniques such as chemokine depletion assays, receptor internalization studies, and intracellular trafficking analyses are particularly valuable. Researchers should also consider the impact of DARC-mediated chemokine scavenging on local chemokine gradients when designing in vivo or ex vivo experiments. Additionally, the expression level of DARC can significantly impact experimental outcomes, necessitating careful quantification and standardization of receptor expression across experimental conditions. Understanding DARC's scavenging function is critical for interpreting results in the context of chemokine homeostasis and inflammatory processes .

What are the optimal expression systems for recombinant Bovine DARC production?

For effective recombinant Bovine DARC production, researchers should consider several expression systems, each with distinct advantages depending on the research objectives. Bacterial expression systems (E. coli) may be suitable for producing DARC fragments or domains for structural studies but are generally less effective for full-length membrane proteins. Insect cell expression systems (Sf9, High Five) offer improved post-translational modifications and are particularly valuable for structural biology applications, including cryo-EM studies. Mammalian expression systems (HEK293, CHO cells) provide the most native-like post-translational modifications and are recommended for functional studies. When selecting an expression system, researchers should consider factors such as required yield, post-translational modifications, and downstream applications. For structural studies similar to those conducted with human DARC, insect cell expression systems have proven particularly effective for obtaining sufficient quantities of properly folded receptor suitable for cryo-EM analysis .

What purification strategies are effective for recombinant Bovine DARC?

Purification of recombinant Bovine DARC requires specialized approaches due to its membrane protein nature. An effective purification strategy typically begins with detergent solubilization using mild detergents such as DDM, LMNG, or GDN to maintain protein integrity. Affinity chromatography utilizing tags such as His, FLAG, or rho1D4 enables initial capture of the receptor. Size exclusion chromatography (SEC) is crucial for ensuring monodispersity and removing aggregates. For structural studies, consider reconstitution into nanodiscs or lipid cubic phase to maintain a native-like membrane environment. Researchers should evaluate protein purity using SDS-PAGE and Western blotting, while functional integrity can be assessed through ligand binding assays. Optimization of buffer conditions, including pH, salt concentration, and stabilizing additives, is essential for maintaining protein stability throughout the purification process .

How can researchers effectively study the chemokine binding properties of Bovine DARC?

To effectively study the chemokine binding properties of Bovine DARC, researchers should employ multiple complementary approaches. Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI) provide real-time binding kinetics and affinity measurements. Isothermal Titration Calorimetry (ITC) offers insights into binding thermodynamics, including enthalpy and entropy contributions. Fluorescence-based assays using labeled chemokines can assess binding in cellular contexts. Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) has proven particularly valuable for uncovering ligand-induced structural changes in DARC and should be considered for detailed binding mechanism studies. Cryo-EM, as demonstrated with human DARC in complex with CCL7, provides structural insights into binding interfaces. Researchers should also consider competition binding assays to evaluate the promiscuous nature of DARC's chemokine recognition. When designing these experiments, it is crucial to account for the superficial binding mode and the primary role of the N-terminus in chemokine recognition .

What strategies can address the challenges in crystallizing Bovine DARC for structural studies?

Addressing the challenges in crystallizing Bovine DARC requires innovative approaches beyond conventional membrane protein crystallization methods. Researchers should consider utilizing fusion proteins such as T4 lysozyme or BRIL inserted into intracellular loops to enhance crystallization propensity while minimizing functional disruption. Antibody fragment co-crystallization, particularly using nanobodies or Fab fragments that recognize conformational epitopes, can stabilize specific receptor conformations and provide crystal contact points. Lipidic cubic phase (LCP) crystallization has proven particularly effective for membrane proteins and should be prioritized over traditional vapor diffusion methods. Considering the successful cryo-EM structure determination of human DARC, researchers might benefit from focusing on single-particle cryo-EM rather than crystallography, especially for full-length DARC studies. Systematic screening of detergents, lipids, and stabilizing ligands is essential for identifying conditions that maintain DARC in a homogeneous, stable state suitable for structural studies .

How can researchers investigate the non-canonical signaling properties of Bovine DARC?

Investigating the non-canonical signaling properties of Bovine DARC requires specialized approaches beyond conventional GPCR signaling assays. Researchers should employ comprehensive phosphoproteomic analyses to identify potential signaling pathways activated in response to chemokine binding, even in the absence of G protein coupling. BRET/FRET-based interaction assays can detect potential recruitment of non-canonical signaling adaptors that might be missed in traditional signaling assays. Transcriptomic and proteomic profiling of cells expressing DARC following chemokine stimulation may reveal subtle signaling events. CRISPR-Cas9 knockout/knockin approaches can help establish the functional relevance of DARC-mediated effects in various cellular contexts. Considering DARC's shortened TM5 and TM6 domains that preclude conventional signaling, researchers should particularly focus on potential signaling mechanisms that do not require the intracellular regions typically involved in G protein coupling .

What techniques are available for monitoring Bovine DARC trafficking and internalization?

For comprehensive analysis of Bovine DARC trafficking and internalization, researchers should employ multiple imaging and biochemical approaches. Live-cell confocal microscopy using fluorescently-tagged DARC provides real-time visualization of receptor movement following chemokine stimulation. TIRF microscopy offers superior resolution for events occurring near the plasma membrane. Flow cytometry-based internalization assays can quantify surface receptor levels following chemokine exposure. Biotin labeling approaches differentiate between internalized and surface receptors. For detailed pathway analysis, researchers should consider utilizing endocytic pathway inhibitors targeting clathrin, caveolin, and dynamin to identify the mechanisms of DARC internalization. Co-localization studies with markers for early endosomes (EEA1), recycling endosomes (Rab11), and lysosomes (LAMP1) help track the post-internalization fate of DARC. Given DARC's unique properties as a non-signaling chemokine receptor, particular attention should be paid to potential differences in internalization mechanisms compared to conventional chemokine receptors .

What structural differences exist between Human and Bovine DARC?

While specific comparative data between Human and Bovine DARC is limited in the provided search results, structural analysis can be approached by examining conserved features and potential species-specific variations. Both human and bovine DARC share the fundamental seven-transmembrane (7TM) architecture characteristic of this receptor family. The key structural feature of human DARC—dramatically shortened TM5 and TM6 on the intracellular side—is likely conserved in bovine DARC, as this structural element underlies the receptor's inability to couple with G proteins and other signaling effectors. The N-terminus, which serves as the primary interaction interface for chemokine binding in human DARC, may exhibit species-specific variations that could influence chemokine binding specificity and affinity. Researchers investigating bovine DARC structure should conduct detailed sequence alignment analyses focusing particularly on the N-terminal domain and extracellular loops that participate in chemokine recognition, as these regions may exhibit the greatest species-specific variations .

How do the chemokine binding profiles differ between Human and Bovine DARC?

The chemokine binding profiles of Human and Bovine DARC likely share fundamental characteristics while potentially differing in specific binding affinities and selectivity patterns. Both receptors are expected to exhibit promiscuous binding to multiple chemokines, particularly of the C-C and C-X-C types, consistent with their role as chemokine scavengers. Human DARC has been shown to employ a relatively superficial binding mode with chemokines, with the N-terminus serving as the key interaction interface. This binding mechanism is likely conserved in Bovine DARC, though species-specific variations in the N-terminal sequence may influence binding affinities for specific chemokines. To characterize these differences, researchers should conduct comparative binding studies using techniques such as surface plasmon resonance, isothermal titration calorimetry, and competition binding assays with a panel of chemokines. Additionally, hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide valuable insights into potential differences in ligand-induced structural changes between the two species variants .

What functional implications arise from species differences in DARC expression patterns?

Species differences in DARC expression patterns can have significant functional implications for research applications and translational relevance. While both human and bovine DARC are expressed in multiple tissue types, including red blood cells, epithelial cells of lung and kidney, endothelial cells of capillaries, and selected brain regions, species-specific variations in expression levels and tissue distribution may exist. These differences can influence chemokine homeostasis in specific tissue microenvironments and affect inflammatory processes differently between species. When designing experiments using bovine models to study DARC-related processes with translational relevance to humans, researchers must carefully consider these potential differences. Comprehensive tissue expression profiling using techniques such as immunohistochemistry, single-cell RNA sequencing, and quantitative PCR is recommended to establish accurate expression maps for bovine DARC across different tissues. These expression patterns should be systematically compared with human data to identify both conserved and species-specific expression profiles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.