Recombinant Bovine E3 ubiquitin-protein ligase MARCH2 (41335)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine E3 Ubiquitin-Protein Ligase MARCH2 (41335)

Recombinant Bovine E3 Ubiquitin-Protein Ligase MARCH2 (41335) is an enzyme that functions as an E3 ubiquitin ligase . E3 ubiquitin ligases, such as MARCH2, facilitate the transfer of ubiquitin to specific substrate proteins, influencing their fate within the cell . MARCH2 is involved in the regulation of inflammatory responses, including antiviral defense and bacterial infection .

Synonyms

  • MARCHF2

  • MARCH2

  • E3 ubiquitin-protein ligase MARCHF2

  • Membrane-associated RING finger protein 2

  • Membrane-associated RING-CH protein II

  • MARCH-II

  • RING-type E3 ubiquitin transferase MARCHF2

Structure and Function

MARCH2 belongs to the MARCH (Membrane-Associated RING-CH) family of E3 ubiquitin ligases . Most MARCH proteins, including MARCH2, possess an N-terminal RING-CH domain and multiple transmembrane (TM) domains . The RING-CH domain is essential for E3 ligase activity, while the TM domains anchor the protein to cellular membranes . MARCH2 may mediate ubiquitination of TFRC and CD86, promoting their endocytosis . It interacts with phosphoglycerate mutase family member 5 (PGAM5) to promote its ubiquitination and degradation .

Cellular Localization and Function

MARCH2 is localized to the endoplasmic reticulum, endosomes, and lysosomes . The PDZ-binding domain of MARCH proteins plays a role in dictating their subcellular localizations . Mutations of the PDZ-binding domain of MARCH2 lead to its retention at the ER .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
MARCHF2; MARCH2; E3 ubiquitin-protein ligase MARCHF2; Membrane-associated RING finger protein 2; Membrane-associated RING-CH protein II; MARCH-II; RING-type E3 ubiquitin transferase MARCHF2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
MARCH2
Target Protein Sequence
MTTGDCCHLPGSLCDCSDSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALETPSD GPFCRICHEGANGESLLSPCGCSGTLGAVHKSCLERWLSSSNTSYCELCHTEFAVEKRSR SLTEWLKDPGPRTEKRTLCCDVVCFLFITPLAAISGWLCLRGAQDHLRLHSHLEALGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVRLKMQADGSEGSQHSPLAAGLLKKVA EETPV
Uniprot No.

Target Background

Function
Recombinant Bovine E3 ubiquitin-protein ligase MARCH2 (41335) is an E3 ubiquitin-protein ligase mediating the ubiquitination of TFRC and CD86. This action promotes their subsequent endocytosis and lysosomal sorting via multivesicular bodies. As an E3 ubiquitin ligase, it accepts ubiquitin from an E2 ubiquitin-conjugating enzyme (via a thioester bond) and directly transfers it to target substrates. MARCH2 may also participate in endosomal trafficking through interaction with STX6.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

What is the primary biological function of E3 ubiquitin-protein ligase MARCH2?

E3 ubiquitin-protein ligase MARCH2 is primarily involved in intracellular vesicular trafficking between compartments. Specifically, MARCH2 functions within the early secretory pathway between the endoplasmic reticulum (ER) and Golgi compartments. Its main mechanism of action involves directing the ubiquitination of target proteins, tagging them for degradation through the ubiquitin-proteasome system. This process helps regulate the level and activity of proteins involved in intracellular transport .

To effectively study MARCH2 function, researchers should examine both its direct ubiquitination targets and the downstream effects on cellular trafficking pathways. Experimental approaches should incorporate both gain-of-function (overexpression) and loss-of-function (knockdown/knockout) strategies to establish causal relationships between MARCH2 activity and observed cellular phenotypes.

How does bovine MARCH2 differ structurally and functionally from human MARCH2?

When investigating bovine MARCH2, researchers should note that while the core RING-CH domain responsible for E3 ligase activity is highly conserved across species, there are species-specific variations in regulatory regions and substrate recognition domains. These differences may manifest as altered binding affinities for certain substrate proteins or variations in cellular localization patterns.

Experimental design should include comparative analyses between bovine and human MARCH2 using techniques such as:

When interpreting cross-species data, researchers should control for expression level differences and consider using chimeric proteins to isolate functionally divergent domains.

What are the optimal experimental conditions for studying MARCH2-mediated ubiquitination in vitro?

Robust in vitro ubiquitination assays for MARCH2 require careful optimization of multiple parameters. Based on established protocols, the following components and conditions are recommended:

  • Purified components: ATP, ubiquitin, E1 (ubiquitin-activating enzyme), appropriate E2 (ubiquitin-conjugating enzyme), purified MARCH2, and the substrate protein of interest (e.g., ERGIC3)

  • Buffer composition:

    • 50 mM Tris-HCl (pH 7.5)

    • 5 mM MgCl₂

    • 2 mM ATP

    • 0.5 mM DTT

    • 1 μM ubiquitin

  • Reaction conditions:

    • Temperature: 30°C

    • Duration: 1-2 hours

    • Gentle agitation

The reaction should be terminated by addition of SDS-PAGE sample buffer and analyzed by immunoblotting with antibodies against the substrate protein and ubiquitin. Control reactions should include omission of individual components and use of catalytically inactive MARCH2 (C64,67S variant) to confirm specificity .

A common methodological error is insufficient purification of the E3 ligase or substrate, which can introduce contaminating enzymes or inhibitors. Additionally, researchers should verify that any tags used for protein purification do not interfere with enzymatic activity or substrate recognition.

How should researchers design experiments to differentiate between direct and indirect effects of MARCH2 on protein trafficking?

Distinguishing direct from indirect effects of MARCH2 requires a multi-faceted experimental approach:

  • Direct substrate identification:

    • Proximity-dependent biotin labeling methods (BioID or TurboID)

    • Stable isotope labeling with amino acids in cell culture (SILAC) combined with quantitative proteomics

    • Immunoprecipitation followed by mass spectrometry

  • Validation of direct interaction:

    • In vitro ubiquitination assays with purified components

    • Yeast two-hybrid or mammalian two-hybrid assays

    • FRET or BRET assays to detect protein-protein interactions in live cells

  • Functional validation:

    • Rescue experiments with catalytically inactive MARCH2 variants

    • Domain mapping to identify interaction regions

    • Ubiquitination site mapping on substrates (e.g., lysine-to-arginine mutations)

  • Temporal analysis:

    • Pulse-chase experiments to track protein degradation kinetics

    • Live-cell imaging with fluorescently tagged proteins to track trafficking in real-time

Control experiments should include analysis of proteins known not to be MARCH2 substrates and comparison with effects of other MARCH family members to establish specificity.

How can researchers effectively study the role of MARCH2 in regulating ERGIC3-dependent protein secretion?

The relationship between MARCH2 and ERGIC3-dependent protein secretion represents a complex regulatory network. A comprehensive experimental approach should include:

  • Secretion assays:

    • Quantify secretion of known ERGIC3-dependent cargo proteins (α1-antitrypsin, haptoglobin) using ELISA or Western blot of conditioned media

    • Compare secretion levels under conditions of MARCH2 overexpression, depletion, and expression of catalytically inactive mutants

  • Trafficking visualization:

    • Fluorescently tag cargo proteins to track their movement through the secretory pathway

    • Use live-cell imaging and photoactivatable probes to measure trafficking kinetics

  • Biochemical analysis:

    • Assess ERGIC3 ubiquitination status using ubiquitin pulldowns followed by immunoblotting

    • Map ubiquitination sites on ERGIC3 (lysine residues 6 and 8 are known targets)

    • Introduce ubiquitination-resistant ERGIC3 variants to determine rescue capability

  • Protein complex analysis:

    • Investigate the ERGIC2-ERGIC3 heteromeric complex formation under varying MARCH2 conditions

    • Examine how MARCH2 affects ERGIC3 homomerization

A key methodology for distinguishing MARCH2 effects from other regulatory mechanisms is to perform rescue experiments with ubiquitination-resistant ERGIC3 variants (K6R, K8R). If these variants restore secretion despite MARCH2 overexpression, this confirms that ubiquitination of ERGIC3 is the primary mechanism by which MARCH2 regulates secretion .

What techniques are most effective for identifying novel substrates of bovine MARCH2?

Identification of novel MARCH2 substrates requires multiple complementary approaches:

  • Proximity-dependent biotin labeling:

    • Generate FLAG-BirA-MARCH2 fusion proteins

    • Express these constructs in bovine cell lines along with AP-HA-Ub

    • Treat cells with biotin and purify biotinylated proteins using streptavidin beads

    • Enrich for ubiquitinated peptides using di-Gly antibody-conjugated beads

    • Analyze by mass spectrometry

  • Quantitative proteomics:

    • Compare the proteome of cells with and without MARCH2 expression

    • Focus on proteins showing decreased abundance with MARCH2 expression

    • Validate with cycloheximide chase assays to confirm accelerated degradation

  • Ubiquitinome analysis:

    • Perform SILAC labeling of cells with and without MARCH2

    • Enrich for ubiquitinated proteins and analyze by mass spectrometry

    • Look for proteins with increased ubiquitination in MARCH2-expressing cells

  • Validation strategy:

Validation StepTechniqueExpected Outcome for True Substrates
Direct interactionCo-immunoprecipitationDetectable interaction with MARCH2
UbiquitinationIn vitro ubiquitination assayIncreased ubiquitination with wild-type but not C64,67S MARCH2
DegradationCycloheximide chaseAccelerated degradation in presence of MARCH2
Functional impactPathway-specific assaysAltered function/localization dependent on MARCH2 activity

When analyzing potential novel substrates, researchers should prioritize candidates that show consistency across multiple detection methods and demonstrate both physical interaction with MARCH2 and functional consequences of this interaction.

How should researchers address discrepancies between in vitro and cellular studies of MARCH2 activity?

Discrepancies between in vitro and cellular studies of MARCH2 are common and may arise from several factors:

  • Substrate accessibility:

    • In cells, potential substrates may be protected by protein complexes or subcellular compartmentalization

    • Solution: Perform fractionation studies to determine the subcellular localization of MARCH2 and potential substrates

  • Co-factor requirements:

    • Cellular MARCH2 activity may depend on additional proteins not included in in vitro assays

    • Solution: Perform mass spectrometry analysis of MARCH2 immunoprecipitates to identify interacting proteins

  • Post-translational modifications:

    • MARCH2 itself may require specific modifications for full activity

    • Solution: Compare the post-translational modification profile of recombinant and cellular MARCH2

  • Experimental design differences:

    • Different E2 enzymes used in vitro versus available in cells

    • Solution: Systematically test multiple E2 enzymes in vitro to identify the physiologically relevant partner

When encountering discrepancies, researchers should consider the following reconciliation approach:

ObservationPotential CauseReconciliation Strategy
Substrate ubiquitinated in vitro but not in cellsLack of cellular co-localizationPerform immunofluorescence to verify spatial overlap
Substrate levels unaffected by MARCH2 in cells despite in vitro ubiquitinationSubstrate may be de-ubiquitinated in cellsTest with deubiquitinase inhibitors
Different ubiquitination sites identified in vitro versus in cellsStructural constraints in cellular environmentPerform structural analysis of substrate in complex with MARCH2

Following systematic analysis, remaining discrepancies should be clearly reported in publications to advance the field's understanding of context-dependent MARCH2 function.

What controls are essential when analyzing the specificity of MARCH2-mediated ubiquitination events?

Rigorous control experiments are critical for establishing the specificity of MARCH2-mediated ubiquitination:

  • Enzymatic controls:

    • Catalytically inactive MARCH2 mutant (C64,67S) to confirm E3 ligase activity dependence

    • Deletion of components from in vitro reactions (E1, E2, ATP) to verify complete ubiquitination cascade requirement

    • Other MARCH family members to assess family-specific versus member-specific effects

  • Substrate controls:

    • Known non-substrate proteins to demonstrate selectivity

    • Lysine-to-arginine mutants of putative substrates at predicted ubiquitination sites to confirm site specificity

    • Domain deletion variants to map recognition elements

  • Cellular context controls:

    • Multiple cell types to ensure consistency across cellular environments

    • MARCH2 knockdown/knockout cells as baseline controls

    • Proteasome inhibitors (e.g., MG132) to distinguish ubiquitination from degradation effects

  • Technical controls:

    • Multiple antibodies targeting different epitopes of MARCH2 and substrate proteins

    • Different tags for protein purification to rule out tag-specific artifacts

    • Multiple ubiquitination detection methods (e.g., anti-ubiquitin blotting, mass spectrometry)

Researchers should particularly focus on ruling out indirect effects by performing in vitro reactions with purified components and validating direct interactions through techniques like yeast two-hybrid or surface plasmon resonance.

How does bovine MARCH2 compare functionally to other members of the MARCH family of E3 ligases?

MARCH (Membrane-Associated RING-CH) family proteins share structural similarities but exhibit distinct functional profiles:

  • Substrate specificity comparison:

    • MARCH2 preferentially targets trafficking proteins like ERGIC3

    • Other MARCH proteins target different substrates (e.g., MARCH1/8 target MHC-II and CD86)

    • Some overlap exists, suggesting potential functional redundancy

  • Subcellular localization patterns:

    • MARCH2: Primarily endosome-to-Golgi network and early secretory pathway

    • MARCH1/8: Primarily endocytic compartments

    • MARCH9: Mainly lysosomal compartments

  • Tissue expression profiles:

    • Comparative RT-qPCR and western blot analysis across tissues reveals distinct expression patterns

    • Functional significance of tissue-specific expression should be evaluated

  • Evolutionary conservation:

    • Phylogenetic analysis reveals which functional domains are most conserved across species

    • Bovine MARCH2 shows higher conservation in catalytic RING-CH domain than in substrate-binding regions

When experimentally comparing MARCH family members, researchers should design studies that evaluate multiple family members in parallel under identical conditions to reveal true functional differences rather than experimental artifacts.

What insights can be gained from studying post-translational modifications of MARCH2 itself?

MARCH2, like many E3 ubiquitin ligases, is subject to post-translational modifications that regulate its activity:

  • Phosphorylation:

    • Potential phosphorylation sites can be predicted using bioinformatic tools

    • Confirmation requires phospho-specific antibodies or mass spectrometry

    • Functional significance should be tested using phosphomimetic (S/T→D/E) and phospho-dead (S/T→A) mutations

  • Auto-ubiquitination:

    • MARCH2 may undergo auto-ubiquitination as a self-regulatory mechanism

    • Differential between K48-linked (degradative) and K63-linked (regulatory) chains should be examined

    • In vitro auto-ubiquitination assays can be performed in the absence of substrate

  • SUMOylation:

    • Potential crosstalk between ubiquitination and SUMOylation pathways

    • May affect MARCH2 stability or substrate recognition properties

  • Experimental approach to PTM profiling:

Modification TypeDetection MethodFunctional Validation
PhosphorylationPhospho-specific antibodies, PhosTag gels, MS/MSPhosphomimetic mutants
UbiquitinationUbiquitin pulldown, linkage-specific antibodiesLysine-to-arginine mutations
SUMOylationSUMO-specific antibodies, SUMO-interacting motif analysisSUMO-site mutations

Understanding MARCH2 modifications provides insight into regulatory mechanisms and can reveal novel approaches for modulating its activity in research contexts.

What are the considerations for developing cell and animal models to study MARCH2 function in physiological contexts?

Developing appropriate model systems for MARCH2 research requires careful consideration of physiological relevance:

  • Cell line selection:

    • Primary bovine cells maintain species-specific regulatory networks

    • Immortalized lines offer experimental convenience but may have altered trafficking pathways

    • Recommended approach: Compare findings between primary cells and established lines

  • Genetic modification strategies:

    • CRISPR/Cas9 for complete knockout

    • siRNA/shRNA for temporary knockdown

    • Inducible expression systems for temporal control

    • Knock-in of tagged versions at endogenous loci to maintain physiological expression levels

  • Animal model considerations:

    • Tissue-specific conditional knockout to avoid developmental phenotypes

    • Reporter systems to visualize trafficking in vivo

    • Physiological readouts relevant to secretory pathway function

  • Experimental design for complex systems:

Model SystemAdvantagesLimitationsBest Applications
Bovine primary cellsPhysiologically relevantLimited lifespan, variableInitial validation of findings
MARCH2 knockout cell linesComplete protein absenceAdaptation/compensationIdentifying essential functions
Inducible expression systemsTemporal controlOften non-physiological levelsAcute response studies
Tissue-specific knockout animalsIn vivo physiological contextResource intensive, complex phenotypesOrganismal function studies

When reporting findings from model systems, researchers should clearly acknowledge limitations and potential compensatory mechanisms that may mask MARCH2 functions.

How can high-throughput screening approaches be optimized to identify modulators of MARCH2 activity?

High-throughput screening (HTS) for MARCH2 modulators requires careful assay development:

  • Primary screening assays:

    • FRET-based ubiquitination assays measuring transfer of fluorescently-labeled ubiquitin

    • Cell-based reporters where substrate degradation is linked to fluorescent or luminescent readout

    • AlphaScreen technology for detecting MARCH2-substrate interactions

  • Secondary validation approaches:

    • In vitro ubiquitination assays with purified components

    • Cellular thermal shift assays (CETSA) to confirm direct binding

    • Effects on known MARCH2-dependent cellular processes (e.g., ERGIC3 degradation)

  • Screening library considerations:

    • Focus on compounds targeting RING domain interactions

    • Include E2-E3 interface disruptors

    • Consider allosteric modulators that may affect substrate recognition

  • Data analysis strategies:

    • Z-factor calculation to ensure assay robustness

    • Dose-response curves to determine potency

    • Counter-screening against related E3 ligases to determine specificity

A common pitfall in HTS for E3 ligase modulators is the high rate of false positives due to non-specific effects on the ubiquitin-proteasome system. Researchers should implement rigorous validation cascades that confirm specificity for MARCH2 versus general effects on protein degradation pathways.

How might single-cell analysis techniques advance our understanding of MARCH2 function in heterogeneous systems?

Single-cell approaches offer new insights into MARCH2 biology:

  • Single-cell transcriptomics:

    • Reveals cell-type specific expression patterns of MARCH2

    • Identifies co-expressed genes that may function in the same pathway

    • Can detect compensatory transcriptional responses to MARCH2 perturbation

  • Single-cell proteomics:

    • Quantifies MARCH2 protein levels at single-cell resolution

    • Correlates MARCH2 levels with substrate protein abundance

    • Captures population heterogeneity missed by bulk analysis

  • Single-cell imaging:

    • Live-cell tracking of MARCH2 and substrate trafficking

    • Quantification of protein half-lives in individual cells

    • Spatial correlation of MARCH2 with potential substrates

  • Integrated analytical approaches:

Single-Cell TechniqueInformation ProvidedExperimental Design Considerations
scRNA-seqExpression correlation networksInclude known MARCH2 interactors as reference points
Mass cytometryProtein abundance relationshipsDevelop specific antibodies against phosphorylated/modified MARCH2
Live-cell imagingDynamic localization patternsUse minimally disruptive tags for MARCH2 fusion proteins
Spatial transcriptomicsTissue location of expressionSelect tissues with known secretory pathway importance

Researchers should be cautious about artifacts introduced by single-cell isolation procedures, particularly for membrane-associated proteins like MARCH2, and should validate findings using complementary approaches.

What are the methodological approaches for investigating potential roles of MARCH2 in pathological conditions?

Investigating MARCH2 in disease contexts requires specialized methodological approaches:

  • Analysis in disease tissues:

    • Immunohistochemistry to assess MARCH2 expression changes

    • Laser capture microdissection followed by qPCR/proteomics

    • Analysis of publicly available disease transcriptome datasets

  • Disease-relevant functional assays:

    • Study MARCH2's impact on secretion of disease-associated proteins

    • Assess trafficking of disease-related receptors

    • Examine stress response in secretory pathway under MARCH2 modulation

  • Genetic association studies:

    • Analyze potential correlations between MARCH2 variants and disease susceptibility

    • Functional characterization of disease-associated variants

    • CRISPR knock-in of variants to establish causality

  • Therapeutic targeting strategies:

    • Develop screening systems for MARCH2 activity modulators

    • Assess specificity across MARCH family members

    • Evaluate effects on physiological versus pathological secretion

When studying MARCH2 in disease contexts, researchers should carefully control for general stress responses in the secretory pathway that may indirectly affect MARCH2 function or substrate availability. Comparative studies between normal and disease conditions should match samples for confounding variables such as age, sex, and tissue source.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.