Recombinant Bovine E3 ubiquitin-protein ligase MARCH3 (MARCH3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MARCHF3; MARCH3; E3 ubiquitin-protein ligase MARCHF3; Membrane-associated RING finger protein 3; Membrane-associated RING-CH protein III; MARCH-III; RING-type E3 ubiquitin transferase MARCHF3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-253
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
MARCH3
Target Protein Sequence
MTTSRCSHLPEVLPDCTGSAAPVVKTVEDCGSLVNGQPQYVMQVSAKDGQLLSTVVRTLA TQSPFNDRPMCRICHEGSSQEDLLSPCECTGTLGTIHRSCLEHWLSSSNTSYCELCHFRF AVERKPRPLVEWLRNPGPQHEKRTLFGDMVCFLFITPLATISGWLCLRGAVDHLHFSSRL EAVGLIALTVALFTIYLFWTLVSFRYHCRLYNEWRRTNQRVILLIPKSVNIPSNQQSLLG LHSAKRNSKETIV
Uniprot No.

Target Background

Function
MARCH3 is a E3 ubiquitin-protein ligase potentially involved in endosomal trafficking. E3 ubiquitin ligases receive ubiquitin from an E2 ubiquitin-conjugating enzyme via a thioester bond and subsequently transfer the ubiquitin to target substrates.
Database Links
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein.

Q&A

What is MARCH3 and what is its primary function in bovine systems?

MARCH3 belongs to the membrane-associated RING-CH-type finger (MARCH) family of E3 ubiquitin ligases. These proteins are critical regulators of immune responses and cellular homeostasis. MARCH3 specifically functions as a late endosome/lysosomal enzyme that catalyzes polyubiquitination of various target proteins, marking them for degradation via distinct routes .

In bovine systems, MARCH3 shares significant homology with human MARCH3, functioning primarily to regulate membrane protein trafficking, endocytosis, and lysosomal degradation pathways. The enzyme contains an N-terminal RING-CH domain that possesses E3 ubiquitin ligase activity, followed by transmembrane domains that anchor it to cellular membranes .

How does MARCH3 differ from other members of the MARCH family?

While all MARCH proteins contain the characteristic RING-CH domain with E3 ubiquitin ligase activity, MARCH3 exhibits distinct subcellular localization and substrate specificity:

MARCH ProteinPrimary LocalizationKey SubstratesRegulation Mechanism
MARCH1Endosomes in APCsMHC-II, CD86TM-mediated dimerization and autoubiquitination
MARCH3Late endosomes/lysosomesJunctional proteinsRING-CH-mediated autoubiquitination
MARCH5MitochondriaMitochondrial proteinsRING-CH-mediated autoubiquitination
MARCH8Endosomes/lysosomesVarious immune receptorsRING-CH-mediated autoubiquitination

Unlike MARCH1, which is primarily expressed in antigen-presenting cells and regulated through TM-mediated dimerization, MARCH3 is more broadly expressed and plays critical roles in endothelial barrier function through regulation of junctional proteins .

What are the optimal experimental designs for studying MARCH3 function in endothelial cells?

When investigating MARCH3 function in endothelial cells, a true experimental design with appropriate controls is recommended to establish causality between MARCH3 activity and endothelial barrier integrity. Based on established research approaches , the following design elements are essential:

  • Random assignment: Cells should be randomly assigned to experimental and control groups to minimize selection bias.

  • Appropriate controls: Include both positive controls (known modulators of endothelial barrier function) and negative controls (non-silencing RNA).

  • Measurement timing: Implement a pretest-posttest control group design to assess barrier function before and after MARCH3 manipulation.

  • Replication: Perform experiments with multiple biological replicates to ensure reliability of results.

For optimal results, a Solomon four-group design may be employed, which includes four randomly allocated groups: (1) MARCH3 silencing with pre/post measurements, (2) MARCH3 silencing with post-measurement only, (3) control with pre/post measurements, and (4) control with post-measurement only . This comprehensive approach helps distinguish between the effects of MARCH3 manipulation and potential testing effects.

How should researchers design siRNA experiments to study MARCH3 function?

Based on successful approaches in the literature , siRNA experiments targeting MARCH3 should follow these methodological guidelines:

  • siRNA selection: Design or select at least 2 non-overlapping siRNA sequences targeting different regions of bovine MARCH3 mRNA to control for off-target effects.

  • Transfection optimization: Determine optimal transfection conditions (reagent concentration, cell density, incubation time) for your specific endothelial cell type.

  • Validation of knockdown: Confirm MARCH3 silencing at both mRNA level (using qRT-PCR) and protein level (using Western blot) 48-72 hours post-transfection.

  • Functional assays: Implement permeability assays using semi-porous collagen-coated membranes to assess endothelial barrier function.

  • Statistical analysis: Apply appropriate statistical tests (ANOVA followed by post-hoc comparisons) to analyze differences between MARCH3-silenced and control groups.

A sample experimental timeline based on published protocols :

DayProcedure
0Seed endothelial cells at optimal density
1Transfect with MARCH3 siRNA or control siRNA
3Split cells and seed onto semi-porous membranes for permeability assays
4Perform baseline permeability measurements
4Stimulate with inflammatory factors (e.g., IL-8, histamine)
4Measure post-stimulation permeability
4Harvest cells for molecular analysis (RNA/protein)

How does MARCH3 regulate endothelial barrier function at the molecular level?

MARCH3 appears to be a critical regulator of endothelial barrier integrity through multiple molecular mechanisms. Transcriptome analysis of MARCH3-depleted cells revealed upregulation of tight junction proteins, particularly occludin (OCLN), suggesting MARCH3 normally suppresses the expression of these critical barrier components .

The molecular pathway connecting MARCH3 to junctional protein expression involves the FoxO1 forkhead transcription repressor. In MARCH3-depleted cells, FoxO1 is inactivated, which relieves its repressive effect on junctional protein expression. This mechanism provides a molecular link between MARCH3 and the signaling pathways governing endothelial barrier integrity .

Additionally, MARCH3 may directly or indirectly modulate the ubiquitination status of tight junction protein complexes. Current evidence suggests that ubiquitin-mediated degradation of junctional proteins like occludin and claudin contributes to barrier disruption. At least two different lysine residues on claudin have been identified as ubiquitin chain acceptors, suggesting potential targets for MARCH3-mediated ubiquitination .

What are the known mechanisms regulating MARCH3 stability and activity?

Like other MARCH family members, MARCH3 stability is tightly regulated by RING-CH finger-mediated autoubiquitination . This self-regulation mechanism allows for precise control of MARCH3 protein levels and activity.

The stability regulation mechanisms of MARCH proteins include:

  • Autoubiquitination: MARCH3, along with MARCH5-8 and MARCH10, undergoes self-catalyzed ubiquitination mediated by their RING-CH domains.

  • Deubiquitination: Although not specifically demonstrated for MARCH3, related family members like MARCH6 are protected from degradation by deubiquitinating enzymes such as USP19, which removes K48-linked polyubiquitin moieties.

  • External E3 ligases: Some MARCH proteins may be targeted for ubiquitination by other E3 ligases, as demonstrated for MARCH1 in HeLa cells.

These regulatory mechanisms suggest potential approaches for experimental manipulation of MARCH3 activity through targeting its stability control systems .

What expression systems are most appropriate for producing recombinant bovine MARCH3?

Producing functional recombinant bovine MARCH3 requires careful consideration of expression systems due to its membrane-associated nature and post-translational modifications. Based on approaches used for similar proteins, the following expression systems may be considered:

  • Mammalian expression systems: HEK293 or CHO cells provide proper folding and post-translational modifications for membrane proteins. These systems are preferable for functional studies requiring properly folded and modified MARCH3.

  • Insect cell expression: Baculovirus-infected Sf9 or High Five cells can produce higher yields while maintaining most post-translational modifications.

  • Bacterial systems with fusion tags: For structural studies of the RING-CH domain, E. coli expression with solubility-enhancing tags (MBP, SUMO, or TRX) may be suitable, though this approach is limited to soluble domains.

For optimal balance between yield and functionality, a mammalian expression system with inducible promoter (e.g., tetracycline-inducible system) is recommended, as it allows for controlled expression of MARCH3, which may otherwise affect host cell viability due to its ubiquitination activity.

What experimental approaches can verify the E3 ligase activity of recombinant bovine MARCH3?

To verify the E3 ligase activity of recombinant bovine MARCH3, several complementary approaches should be employed:

  • In vitro ubiquitination assays: Reconstitute the ubiquitination reaction using purified components:

    • Recombinant MARCH3 (E3)

    • Ubiquitin-activating enzyme (E1)

    • Ubiquitin-conjugating enzyme (E2, typically UbcH5 family members)

    • Ubiquitin (preferably tagged for detection)

    • ATP regeneration system

    • Potential substrate proteins

    Monitor ubiquitin conjugation by Western blotting using anti-ubiquitin antibodies.

  • Autoubiquitination assays: Assess MARCH3's ability to catalyze its own ubiquitination, a characteristic property of many RING-type E3 ligases.

  • Substrate ubiquitination in cellular systems: Co-express MARCH3 with potential substrates in mammalian cells and analyze changes in substrate ubiquitination and stability.

  • E3 ligase-dead controls: Generate a catalytically inactive MARCH3 mutant by introducing point mutations in the RING-CH domain (typically changing critical zinc-coordinating cysteine residues) to serve as a negative control.

A key functional readout would be to compare the effects of wild-type MARCH3 versus catalytically inactive MARCH3 on endothelial barrier function using permeability assays as described in published studies .

How can researchers effectively study the role of MARCH3 in endothelial barrier function?

To comprehensively investigate MARCH3's role in endothelial barrier function, a multi-faceted experimental approach is recommended:

  • Gene silencing approaches:

    • siRNA-mediated knockdown as previously demonstrated

    • CRISPR/Cas9-mediated knockout for complete elimination of MARCH3

    • Inducible shRNA systems for temporal control of MARCH3 depletion

  • Barrier function assessment:

    • Transendothelial electrical resistance (TEER) measurements

    • Permeability assays using fluorescent tracers of different molecular weights

    • Live-cell imaging of barrier dynamics using junction-targeted fluorescent proteins

  • Stimulus challenge models:

    • Inflammatory cytokines (IL-8, TNF-α)

    • Vasoactive agents (histamine, thrombin)

    • Pathogen-associated molecular patterns (LPS)

  • In vivo validation:

    • Tissue-specific MARCH3 knockout in endothelial cells

    • Intravital microscopy to assess vascular leakage

    • Inflammatory challenge models

Based on previous findings, researchers should pay particular attention to the effects of MARCH3 manipulation on tight junction protein expression and localization, especially occludin and claudins, as these appear to be key mediators of MARCH3's effects on barrier function .

What approaches can be used to identify novel substrates of bovine MARCH3?

Identifying novel substrates of MARCH3 requires methodical approaches that can capture the transient enzyme-substrate interactions and ubiquitination events. The following complementary strategies are recommended:

  • Proximity-based biotinylation (BioID or TurboID):

    • Fuse MARCH3 to a promiscuous biotin ligase

    • Express in relevant cell types

    • Purify biotinylated proteins

    • Identify by mass spectrometry

  • Ubiquitinome analysis:

    • Compare ubiquitinated proteins in cells with and without MARCH3 expression

    • Use tandem ubiquitin binding entities (TUBEs) to enrich ubiquitinated proteins

    • Apply stable isotope labeling (SILAC) for quantitative comparison

  • Protein stability profiling:

    • Perform global protein stability profiling in cells with manipulated MARCH3 levels

    • Use cycloheximide chase assays to verify stability changes of candidate proteins

  • Targeted validation approaches:

    • Co-immunoprecipitation of MARCH3 with candidate substrates

    • In vitro ubiquitination assays with purified components

    • Mutational analysis of potential ubiquitination sites on substrates

When analyzing data from these approaches, focus on membrane proteins, particularly those involved in cell junctions, vesicular trafficking, and immune regulation, as these functional categories align with MARCH3's known biological roles .

What statistical approaches are most appropriate for analyzing MARCH3 knockdown experiments?

The appropriate statistical analysis for MARCH3 knockdown experiments depends on the experimental design and outcome measures. Based on published methodologies , the following approaches are recommended:

  • For permeability assays with multiple treatment groups:

    • One-way ANOVA followed by appropriate post-hoc tests (Tukey's or Dunnett's)

    • Include multiple comparison corrections when testing multiple hypotheses

    • Consider repeated measures ANOVA for time-course experiments

  • For gene expression analysis:

    • Paired t-tests for comparing MARCH3-silenced vs. control samples

    • ANCOVA with appropriate covariates when analyzing multiple genes

    • Adjust for multiple testing using Benjamini-Hochberg procedure

  • For factorial designs with multiple treatments:

    • Two-way or three-way ANOVA to assess main effects and interactions

    • Mixed-effects models for experiments with random and fixed factors

  • Power analysis considerations:

    • Calculate required sample sizes based on expected effect sizes

    • Aim for statistical power of at least 0.8 (80% chance of detecting an effect)

    • Report effect sizes alongside p-values for better interpretation

Example of power analysis for MARCH3 knockdown experiments:

Effect SizeSample Size (per group)PowerAlpha Level
Small (0.2)640.80.05
Medium (0.5)120.80.05
Large (0.8)70.80.05

For most MARCH3 functional studies, medium to large effect sizes are typically observed when measuring barrier function parameters, suggesting sample sizes of 7-12 biological replicates per group would be appropriate .

How should researchers address contradictory findings in MARCH3 research?

When faced with contradictory findings in MARCH3 research, researchers should apply a systematic approach:

  • Methodological differences assessment:

    • Compare experimental models (cell types, species differences)

    • Evaluate knockdown/knockout efficiency and verification methods

    • Assess timing of measurements relative to MARCH3 manipulation

    • Review the specificity of reagents (antibodies, siRNAs, detection methods)

  • Context-dependent function analysis:

    • Consider cell-type specific effects of MARCH3

    • Evaluate the impact of inflammatory status or cell activation state

    • Assess potential compensatory mechanisms from other MARCH family members

  • Substrate specificity considerations:

    • Different substrates may be preferentially targeted in different contexts

    • Expression levels of substrates may vary across experimental systems

    • Post-translational modifications of MARCH3 may alter substrate specificity

  • Experimental design reconciliation:

    • Implement more comprehensive designs (e.g., Solomon four-group design)

    • Introduce additional control conditions to rule out confounding factors

    • Apply more sensitive or specific analytical techniques

When publishing findings that contradict existing literature, researchers should explicitly address the discrepancies, propose testable hypotheses to explain them, and suggest critical experiments that could resolve the contradictions .

What are the implications of MARCH3 research for vascular disease?

Given MARCH3's role in regulating endothelial barrier function, research on this E3 ligase has significant implications for vascular diseases characterized by barrier dysfunction:

  • Inflammatory vascular disorders:

    • MARCH3 inhibition could potentially strengthen endothelial barriers during inflammatory challenges

    • This might offer therapeutic approaches for conditions like sepsis, acute respiratory distress syndrome, and ischemia-reperfusion injury

  • Chronic vascular pathologies:

    • Dysregulated MARCH3 activity might contribute to chronic vascular leakage in diseases like diabetic retinopathy and atherosclerosis

    • Long-term modulation of MARCH3 could be explored as a strategy to restore barrier integrity

  • Cancer and angiogenesis:

    • MARCH3's effects on endothelial junctions may influence tumor vessel normalization

    • Targeting MARCH3 could potentially improve drug delivery to tumors by normalizing vascular permeability

Research models testing these translational implications should include both in vitro endothelial models exposed to disease-relevant stressors and in vivo models of vascular pathology with endothelial-specific MARCH3 manipulation .

What innovative techniques could advance understanding of MARCH3 biology?

Several cutting-edge techniques could significantly advance our understanding of MARCH3 biology:

  • Single-cell technologies:

    • Single-cell RNA-seq to identify cell type-specific responses to MARCH3 manipulation

    • Single-cell proteomics to assess protein-level changes in MARCH3-depleted cells

    • Spatial transcriptomics to map MARCH3 activity in tissue contexts

  • Advanced imaging approaches:

    • Super-resolution microscopy to visualize MARCH3 localization relative to endosomal compartments

    • FRET-based sensors to monitor MARCH3 activity in real-time

    • Correlative light and electron microscopy to study MARCH3's role in membrane dynamics

  • Genetic engineering:

    • CRISPR interference (CRISPRi) for tunable MARCH3 repression

    • CRISPR activation (CRISPRa) for controlled overexpression

    • Knock-in of tagged endogenous MARCH3 for physiological expression levels

  • Structural biology:

    • Cryo-EM structures of MARCH3 in complex with E2 enzymes and substrates

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • AlphaFold-based predictions to guide structure-function studies

  • Systems biology approaches:

    • Multi-omics integration to map MARCH3-dependent networks

    • Mathematical modeling of MARCH3's role in barrier dynamics

    • Network analysis to identify central nodes in MARCH3-regulated pathways

These innovative approaches would complement traditional biochemical and cell biological techniques, providing comprehensive insights into MARCH3 function in normal physiology and disease contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.