Recombinant Bovine E3 ubiquitin-protein ligase RNF128 (RNF128)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RNF128; E3 ubiquitin-protein ligase RNF128; RING finger protein 128; RING-type E3 ubiquitin transferase RNF128
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-431
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
RNF128
Target Protein Sequence
AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVPGDWGSSVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEV IPMSHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSF FIITAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTQKQGDKEIGPDGD SCAVCIELYKPNDLVRILTCNHVFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGS VSLQVPVSNETSSNASPHEEDNRSETASSGYASVQGADEPPLEEHAHSANENLQLVNHEA NSMAVDVVPHVDNPTFEEDESPDQETTVREIKS
Uniprot No.

Target Background

Function
Recombinant Bovine E3 ubiquitin-protein ligase RNF128 (RNF128) is an E3 ubiquitin-protein ligase that catalyzes the formation of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. It functions as a cytokine gene transcription inhibitor, specifically suppressing IL2 and IL4 transcription. This plays a crucial role in inducing anergy, a state of long-term T-lymphocyte unresponsiveness and interleukin production blockade. RNF128 ubiquitinates ARPC5 (Lys-48 linkages) and COR1A (Lys-63 linkages), targeting them for degradation. This downregulation of cytoskeletal components impairs lamellipodium formation and reduces F-actin accumulation at the immunological synapse. Furthermore, RNF128 participates in dorsal ectoderm patterning, sensitizing the ectoderm to neural-inducing signals.
Database Links
Subcellular Location
Endomembrane system; Single-pass membrane protein. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region.

Q&A

What is the basic structure and function of RNF128?

RNF128 is a membrane-localized E3 ubiquitin ligase containing several key structural domains that facilitate its cellular functions. The protein consists of:

  • A signal peptide at the N-terminus essential for proper targeting and transport

  • A protease-associated (PA) domain that is evolutionarily conserved and responsible for target protein capture

  • A transmembrane domain that anchors the protein to cellular membranes

  • A C-terminal RING finger domain that contains highly conserved cysteine residues (positions 277 and 280) critical for catalytic E3 ligase activity

Functionally, RNF128 catalyzes the addition of ubiquitin chains to target proteins, particularly promoting Lys63-linked polyubiquitination rather than Lys48-linked chains. This type of modification typically alters protein trafficking and function rather than targeting proteins for proteasomal degradation. In macrophages, RNF128 has been shown to play a significant role in foam cell formation, a critical process in atherosclerosis development .

What is the tissue-specific expression pattern of RNF128?

Based on single-cell RNA sequencing data, RNF128 demonstrates a specific expression pattern in macrophages located within the lipid core of atherosclerotic plaques. Importantly, research has shown that persistent hyperlipidemia induces elevated expression of RNF128 in macrophages, suggesting that lipid levels directly influence RNF128 expression . This specific localization and regulation pattern highlights the potential role of RNF128 as a mediator between lipid metabolism and inflammatory processes in atherosclerosis.

When investigating RNF128 expression, researchers should consider:

  • Cell-type specific analysis using single-cell techniques

  • Examination of expression under various metabolic conditions

  • Comparative expression analysis across different tissue types

  • Verification of expression patterns using multiple methodologies (RNA-seq, qPCR, Western blot)

How evolutionarily conserved is RNF128 across species?

Research indicates that critical functional domains of RNF128 demonstrate high evolutionary conservation across species. Particularly, the cysteine residues at positions 277 and 280 within the RING domain, which are essential for E3 catalytic activity, are highly conserved . Similarly, the PA domain of RNF128, which captures target proteins for cytosolic ubiquitination, shows evolutionary conservation .

The lysine 478 residue on SRB1, which serves as the ubiquitination site for RNF128, is also highly conserved between humans and mice, suggesting functional importance across species . This conservation indicates that the RNF128-SRB1 interaction mechanism may be a fundamental biological process preserved throughout evolution.

What are the optimal approaches for producing recombinant RNF128 protein?

To produce high-quality recombinant RNF128 protein for research purposes, consider the following methodological approach:

  • Expression System Selection: HEK293T cells have been successfully used for RNF128 expression due to their ability to perform post-translational modifications. For the production of bovine RNF128 specifically, mammalian expression systems are preferred over bacterial systems to ensure proper folding and modification .

  • Construct Design: Include appropriate tags (e.g., Flag, Myc) for detection and purification. The research demonstrates successful expression using Flag-tagged RNF128 constructs. Consider generating both full-length and domain-specific constructs:

    • Full-length RNF128 (RNF128-WT)

    • RNF128 without RING domain (RNF128-ΔR)

    • RNF128 lacking signal peptide (RNF128-ΔSP)

    • N-terminus with PA domain (RNF128-N)

    • C-terminus with RING finger (RNF128-C)

  • Transfection and Expression: Lipid-based transfection methods have shown effectiveness for RNF128 plasmid delivery. For viral delivery in primary cells, adenovirus systems with controlled multiplicity of infection (MOI) have demonstrated concentration-dependent expression .

  • Purification Strategy: Use affinity chromatography based on the incorporated tag, followed by size exclusion chromatography to obtain pure, properly folded protein.

  • Functional Validation: Confirm E3 ligase activity through in vitro ubiquitination assays before using the recombinant protein in experiments .

What methods are most effective for detecting and quantifying RNF128 in biological samples?

For accurate detection and quantification of RNF128 in biological samples, researchers should employ multiple complementary techniques:

  • Western Blotting:

    • Use specific antibodies against RNF128 or epitope tags (Flag, Myc) for tagged recombinant proteins

    • Include appropriate positive and negative controls, especially RNF128-knockout samples

    • For membrane localization studies, perform membrane protein extraction using biotinylation of intact cells followed by avidin affinity purification

  • Immunoprecipitation (IP) and Co-IP:

    • Effective for detecting RNF128-protein interactions and analyzing ubiquitination patterns

    • Successfully used to determine binding between RNF128 and SRB1 in multiple studies

    • Can be combined with ubiquitination analysis using antibodies specific to different ubiquitin linkages (K48, K63)

  • Microscopy Techniques:

    • Immunofluorescence for colocalization studies (e.g., RNF128 with SRB1, or SRB1 with LAMP2)

    • Confocal microscopy for detailed subcellular localization

    • Quantitative image analysis for protein trafficking studies

  • Quantitative PCR:

    • For mRNA expression analysis across tissues or under different conditions

    • Should be used in conjunction with protein-level analysis

  • Single-Cell RNA Sequencing:

    • Powerful for determining cell-type specific expression patterns

    • Has been successfully used to identify RNF128 expression in macrophages of the lipid core

How can researchers effectively evaluate the enzymatic activity of RNF128?

To evaluate the enzymatic activity of RNF128 as an E3 ubiquitin ligase, researchers should implement the following methodological approaches:

  • In Vitro Ubiquitination Assays:

    • Reconstitute the ubiquitination reaction using purified components: E1, E2, RNF128 (E3), ubiquitin, ATP, and substrate (e.g., SRB1)

    • Include controls with catalytically inactive RNF128 mutants (RNF128 ΔR or point mutants C277A and C280A)

    • Test different ubiquitin variants to distinguish between ubiquitin chain types (wild-type Ub, K48-only, K63-only)

  • Cell-Based Ubiquitination Assays:

    • Co-transfect cells with RNF128, substrate protein (e.g., Myc-SRB1), and HA-tagged ubiquitin variants

    • Immunoprecipitate the substrate and detect ubiquitination by Western blotting with anti-HA antibody

    • Compare ubiquitination patterns between wild-type RNF128 and catalytically inactive mutants

  • Domain-Function Analysis:

    • Generate specific domain mutations or deletions (e.g., RING domain deletion)

    • Evaluate the impact on ubiquitination activity and substrate binding

    • Research has shown that RNF128 ΔR loses the ability to stabilize SRB1

  • Substrate Specificity Testing:

    • Identify potential lysine residues on the substrate that may be ubiquitinated

    • Generate point mutations (K→R) of these residues

    • For SRB1, K478 was identified as the critical residue for RNF128-mediated K63-linked polyubiquitination

  • Functional Outcomes Assessment:

    • Examine downstream effects of RNF128 activity, such as:

      • Substrate protein stability/degradation

      • Membrane localization changes

      • Interaction with trafficking proteins (e.g., Rab11)

How does RNF128 achieve specificity in ubiquitination targeting?

RNF128 demonstrates remarkable specificity in its ubiquitination targeting through multiple regulatory mechanisms:

  • Domain-Specific Substrate Recognition:

    • The protease-associated (PA) domain in the N-terminus of RNF128 is crucial for target recognition. Studies have shown that RNF128 lacking the PA domain (RNF128-ΔPA) loses its ability to interact with SRB1, while a GFP-tagged recombinant protein containing only the PA domain (RNF128-PA) efficiently binds with SRB1 .

    • The signal peptide at the N-terminus is essential for proper trafficking to substrate-rich cellular regions. Research demonstrates that RNF128-ΔSP cannot interact with SRB1, likely due to transport incompetence .

  • Substrate Domain Specificity:

    • RNF128 exhibits precise domain recognition on its substrates. For SRB1, RNF128 specifically interacts with the extracellular region. SRB1 lacking the extracellular domain (SRB1-ΔEXT) cannot interact with RNF128 .

    • The selection of lysine 478 on SRB1's cytoplasmic C-terminus for ubiquitination demonstrates site-specific modification capability .

  • Ubiquitin Chain-Type Specificity:

    • RNF128 selectively catalyzes K63-linked polyubiquitination rather than K48-linked chains. This specificity was confirmed through:

      • Transfection experiments with wild-type ubiquitin and mutant ubiquitins (K48 and K63)

      • Analysis of endogenous SRB1 ubiquitination in macrophages

      • In vitro ubiquitination assays

  • Functional Outcome Specificity:

    • Unlike many E3 ligases that promote degradation, RNF128-mediated K63-linked polyubiquitination specifically promotes recycling of SRB1 to the plasma membrane, preventing lysosomal degradation .

What structural requirements influence RNF128 catalytic activity?

The catalytic activity of RNF128 depends on several critical structural elements:

  • RING Domain Integrity:

    • The RING finger domain in the C-terminus is essential for E3 ligase activity

    • Deletion of the RING domain (RNF128 ΔR) abolishes RNF128's ability to:

      • Stabilize SRB1

      • Catalyze polyubiquitination

      • Promote SRB1-Rab11 interaction

  • Critical Catalytic Residues:

    • Cysteine residues at positions 277 and 280 within the RING domain are highly conserved across species

    • Point mutations C277A and C280A (RNF128 C2A) dramatically reduce E3 catalytic activity

    • These residues are likely involved in zinc coordination within the RING structure, essential for E3 ligase function

  • Proper Protein Localization:

    • The signal peptide at the N-terminus is required for correct targeting

    • RNF128 lacking the signal peptide (RNF128-ΔSP) fails to interact with substrates

    • Membrane localization positions RNF128 to access membrane-associated substrates like SRB1

  • Domain Coordination:

    • The PA domain binds substrates while the RING domain executes catalysis

    • This spatial arrangement facilitates efficient ubiquitination

    • Research demonstrates that both domains must be functional for effective ubiquitination

  • Substrate Presentation:

    • The transmembrane orientation of RNF128 positions its catalytic domain intracellularly

    • This alignment enables access to the cytosolic C-terminus of SRB1 where K478 is located

    • Proper structural alignment between enzyme and substrate is critical for site-specific ubiquitination

How does RNF128 interact with the cellular trafficking machinery?

RNF128 interacts with cellular trafficking machinery through a sophisticated mechanism that alters substrate protein fate:

  • Rab11-Dependent Recycling Pathway:

    • RNF128-mediated K63-linked polyubiquitination of SRB1 promotes its association with Rab11

    • Rab11 is a small GTPase known to regulate endosomal recycling to the plasma membrane

    • This interaction diverts SRB1 from the degradative pathway to the recycling pathway

  • Prevention of Lysosomal Targeting:

    • RNF128 overexpression reduces the interaction between SRB1 and LAMP2 (lysosomal-associated membrane protein 2)

    • Co-immunoprecipitation assays confirm that RNF128 reduces SRB1-LAMP2 association

    • This diverts SRB1 away from lysosomal degradation, increasing its membrane localization

  • Ubiquitination-Dependent Trafficking:

    • The K63-linked polyubiquitination at K478 serves as a molecular signal for the recycling machinery

    • Mutation of this residue (K478R) prevents RNF128-induced recycling

    • Even with RNF128 overexpression, SRB1 K478R fails to show increased membrane localization

  • E3 Ligase Activity Requirement:

    • The RING domain of RNF128 is essential for promoting SRB1-Rab11 interaction

    • RNF128 ΔR (lacking the RING domain) cannot facilitate this interaction

    • This demonstrates that catalytic activity, not merely protein binding, is required for trafficking alteration

  • Recycling-Degradation Balance:

    • Inhibition of lysosomal degradation increases total SRB1 levels but does not restore membrane SRB1 in RNF128-KO cells

    • This indicates that RNF128 specifically affects the recycling pathway rather than just preventing degradation

    • The balance between recycling and degradation pathways determines steady-state SRB1 distribution

What is the role of RNF128 in atherosclerosis development?

RNF128 plays a critical role in atherosclerosis development through several interconnected mechanisms:

  • Macrophage-Specific Expression Pattern:

    • Single-cell RNA sequencing data reveals that RNF128 is specifically expressed in macrophages within the lipid core of atherosclerotic plaques

    • Persistent hyperlipidemia induces high expression of RNF128 in macrophages, creating a pathological feedback loop

  • Promotion of Foam Cell Formation:

    • RNF128 directly binds to scavenger receptor B1 (SRB1) and prevents its degradation

    • This stabilization enhances oxidized low-density lipoprotein (oxLDL) uptake

    • The resulting lipid accumulation promotes foam cell formation, a hallmark of atherosclerotic plaques

  • Enhanced Inflammatory Response:

    • RNF128-mediated SRB1 stabilization promotes oxLDL-induced inflammatory responses in macrophages

    • This contributes to the chronic inflammation characteristic of atherosclerotic lesions

  • Genetic Evidence from Mouse Models:

    • RNF128 ablation in macrophages ameliorates atherosclerosis in both male and female mice

    • This protective effect is observed in both ApoE-deficient and LDLR-deficient backgrounds

    • These findings establish a causal relationship between RNF128 activity and atherosclerosis progression

  • Molecular Mechanism:

    • RNF128 catalyzes K63-linked polyubiquitination of SRB1 at lysine 478

    • This modification promotes SRB1 recycling to the cell membrane via Rab11

    • The increased membrane localization of SRB1 enhances lipid uptake capacity

    • Interrupting this pathway could represent a therapeutic strategy

How can RNF128 knockout or inhibition be used in experimental disease models?

RNF128 knockout or inhibition provides valuable experimental approaches for investigating disease mechanisms and potential therapeutic interventions:

  • Conditional Knockout Strategies:

    • Macrophage-specific RNF128 knockout (RNF128-CKO) models have been successfully generated and show reduced atherosclerosis

    • This approach allows precise analysis of cell-type specific contributions to disease

    • Researchers should consider:

      • Cre-lox systems with macrophage-specific promoters

      • Timing of knockout induction to distinguish developmental from acute effects

      • Verification of knockout efficiency at protein level

  • Domain-Specific Functional Analysis:

    • Expression of dominant negative RNF128 variants lacking the RING domain (RNF128 ΔR)

    • Point mutations of critical catalytic residues (C277A and C280A)

    • These approaches can dissect specific functions of RNF128 domains in disease progression

  • Rescue Experiments:

    • Re-expression of wild-type or mutant RNF128 in knockout models provides critical validation

    • Studies demonstrate that wild-type RNF128, but not RNF128 ΔR, can restore SRB1 protein levels in RNF128-CKO macrophages

    • This approach confirms specificity and mechanism of action

  • Substrate Mutation Approaches:

    • Expression of ubiquitination-resistant SRB1 (K478R) can mimic RNF128 inhibition effects

    • This strategy helps distinguish between multiple RNF128 targets and isolate SRB1-specific effects

  • Pharmacological Inhibition:

    • Development of small molecules targeting the RING domain catalytic activity

    • Peptide inhibitors disrupting RNF128-SRB1 interaction (targeting the PA domain)

    • These approaches could translate mechanistic findings toward therapeutic applications

What other pathological conditions might involve RNF128 dysfunction?

Based on the molecular mechanisms and pathways involving RNF128, several other pathological conditions might involve RNF128 dysfunction:

  • Other Lipid Metabolism Disorders:

    • Non-alcoholic fatty liver disease (NAFLD): Given RNF128's role in lipid uptake and foam cell formation, it might contribute to hepatic lipid accumulation

    • Metabolic syndrome: The interaction between RNF128 and lipid metabolism suggests potential involvement in systemic metabolic disorders

  • Inflammatory Conditions:

    • Chronic inflammatory diseases: RNF128's role in inflammatory responses in macrophages suggests it might influence other inflammatory conditions

    • Autoimmune disorders: As an E3 ligase affecting protein trafficking, RNF128 might regulate immune receptor turnover and signaling

  • Cancer Progression:

    • Tumor-associated macrophages (TAMs) play crucial roles in cancer progression

    • RNF128's macrophage-specific expression and role in cellular signaling suggest potential involvement in TAM function

    • The ubiquitination pathway is frequently dysregulated in cancer

  • Neurodegenerative Diseases:

    • Protein trafficking and degradation defects are common in neurodegenerative conditions

    • RNF128's role in regulating protein fate through ubiquitination might influence neuronal protein homeostasis

    • Macrophage-like microglial cells in the brain could potentially express RNF128 under pathological conditions

  • Infectious Diseases:

    • Macrophages represent a first line of defense against pathogens

    • RNF128's expression in macrophages suggests potential roles in host-pathogen interactions

    • Some pathogens are known to manipulate the ubiquitination system to evade immunity

What are common challenges in expressing and purifying functional recombinant RNF128?

Researchers frequently encounter several challenges when expressing and purifying functional recombinant RNF128:

  • Membrane Protein Solubility Issues:

    • As a membrane-localized protein, RNF128 contains hydrophobic regions that can cause aggregation

    • Solution: Use mild detergents during extraction; consider fusion tags that enhance solubility; develop truncated constructs lacking transmembrane domains for specific applications

  • Maintaining E3 Ligase Activity:

    • The catalytic RING domain requires proper folding and metal coordination

    • Solution: Include zinc in purification buffers; avoid strong reducing agents that might disrupt zinc-binding cysteines; verify activity through in vitro ubiquitination assays

  • Signal Peptide Processing:

    • The N-terminal signal peptide affects targeting but may be processed differently in heterologous systems

    • Solution: Compare constructs with and without the signal peptide; use mammalian expression systems for more physiological processing

  • Domain Integrity and Protein Stability:

    • Multi-domain proteins like RNF128 can be susceptible to degradation during expression and purification

    • Solution: Optimize expression conditions (temperature, induction); use protease inhibitors; consider domain-specific constructs for particular applications

  • Post-translational Modifications:

    • E3 ligases themselves are often regulated by post-translational modifications

    • Solution: Use mammalian or insect cell expression systems that maintain relevant modifications; analyze modification status by mass spectrometry

How can researchers resolve contradictory findings in RNF128 studies?

When facing contradictory findings in RNF128 studies, researchers should implement a systematic approach:

What controls are essential for validating RNF128 ubiquitination activity?

To rigorously validate RNF128 ubiquitination activity, the following controls are essential:

  • Catalytic Inactive Mutants:

    • RING domain deletion mutant (RNF128 ΔR)

    • Point mutations of critical catalytic residues (C277A and C280A in RNF128 C2A)

    • These mutants should display minimal ubiquitination activity compared to wild-type RNF128

  • Ubiquitin Chain-Type Controls:

    • Wild-type ubiquitin (Ub)

    • K48-only ubiquitin (K48)

    • K63-only ubiquitin (K63)

    • These variants help distinguish between different ubiquitin linkage types catalyzed by RNF128

  • Substrate Mutation Controls:

    • Wild-type substrate (e.g., SRB1)

    • Target lysine mutants (e.g., SRB1 K478R)

    • Multiple lysine mutations (e.g., SRB1-K0)

    • Single-lysine reintroduction mutants

    • These constructs verify the specific ubiquitination site and linkage specificity

  • Genetic Knockout Validation:

    • RNF128-knockout cells or tissues (e.g., RNF128-CKO macrophages)

    • Matched wild-type controls

    • Rescue experiments with wild-type and mutant RNF128

    • These genetic controls confirm specificity and rule out compensatory mechanisms

  • In Vitro Reconstitution Controls:

    • Complete reaction (E1, E2, RNF128, substrate, ubiquitin, ATP)

    • Reactions missing individual components

    • Time-course analysis to track reaction progression

    • These biochemical controls verify direct catalytic activity and rule out contaminating enzymes

DomainPositionFunctionExperimental Evidence
Signal PeptideN-terminusProper targeting and transportRNF128-ΔSP loses ability to interact with SRB1
PA DomainN-terminusTarget protein captureRNF128-ΔPA cannot bind SRB1; RNF128-PA efficiently binds SRB1
Transmembrane DomainMiddle regionMembrane anchoringRequired for proper localization
RING DomainC-terminusCatalytic E3 ligase activityRNF128 ΔR lacks ubiquitination activity and stabilization function
Critical Cysteines (C277, C280)Within RING domainZinc coordination for catalysisC277A and C280A mutations abolish E3 ligase activity

Table 2: Comparison of RNF128-Mediated Ubiquitination Types and Their Functional Outcomes

Ubiquitination TypeRNF128 ActivityFunctional OutcomeDetection Method
K63-linkedStrongly promotedRecycling to plasma membraneWestern blot, IP with K63-specific antibodies
K48-linkedNot affectedProteasomal degradationWestern blot, IP with K48-specific antibodies
Wild-type ubiquitinPromotedMixed outcomes, primarily recyclingWestern blot, IP with pan-ubiquitin antibodies

What are promising approaches for targeting RNF128 in therapeutic applications?

Based on current understanding of RNF128 biology, several promising therapeutic approaches emerge:

  • Small Molecule Inhibitors:

    • Targeting the RING domain's catalytic activity

    • Structure-based drug design focusing on the highly conserved cysteines (C277, C280)

    • Allosteric inhibitors that disrupt domain coordination without directly binding the active site

  • Protein-Protein Interaction Disruptors:

    • Peptide-based or small molecule inhibitors targeting the RNF128-SRB1 interaction

    • Focus on the PA domain which is critical for substrate recognition

    • These could specifically block RNF128's effect on SRB1 while preserving other functions

  • siRNA and Antisense Oligonucleotides:

    • Macrophage-targeted delivery systems for RNF128-specific siRNA

    • Enhancing specificity through targeting conserved regions of RNF128 mRNA

    • This approach could provide tissue-specific knockdown without permanent genetic modification

  • Substrate-Specific Approaches:

    • Development of decoy peptides mimicking the SRB1 K478 region

    • These could compete with endogenous SRB1 for RNF128 binding

    • Such an approach might achieve functional specificity without directly inhibiting the enzyme

  • Ubiquitination-Resistant SRB1 Variants:

    • Gene therapy approaches delivering K478R mutant SRB1

    • This could specifically block the RNF128-mediated effect while maintaining other SRB1 functions

    • Most suitable for proof-of-concept studies rather than immediate clinical applications

How might advanced structural biology techniques enhance our understanding of RNF128?

Advanced structural biology techniques could dramatically enhance our understanding of RNF128's function and regulation:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Determination of RNF128's full-length structure, including transmembrane regions

    • Visualization of the RNF128-SRB1 complex

    • Structural analysis of the entire ubiquitination machinery (E1-E2-RNF128-substrate complex)

    • These structures would reveal precise molecular interactions and conformational changes

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Analysis of protein dynamics and conformational changes upon substrate binding

    • Identification of allosteric sites that could be targeted for inhibitor development

    • This technique provides information about protein flexibility not readily accessible by static structural methods

  • Single-Molecule FRET:

    • Real-time monitoring of RNF128-substrate interactions

    • Analysis of conformational changes during the catalytic cycle

    • Investigation of how ubiquitination affects substrate trafficking

    • This approach would provide dynamic information about the ubiquitination process

  • AlphaFold and Computational Approaches:

    • Prediction of RNF128 structure and interaction interfaces

    • Virtual screening for potential inhibitors

    • Simulation of ubiquitin chain building process

    • These methods could guide experimental approaches and accelerate discovery

  • In-Cell NMR:

    • Analysis of RNF128 structure and interactions in a native cellular environment

    • Investigation of how cellular factors influence RNF128 activity

    • This technique bridges the gap between in vitro structural studies and cellular function

What is the potential impact of RNF128 research on personalized medicine approaches?

RNF128 research has significant potential to impact personalized medicine approaches, particularly in cardiovascular disease management:

  • Biomarker Development:

    • RNF128 expression levels or activity in circulating monocytes could serve as biomarkers for atherosclerosis risk

    • Analysis of SRB1 ubiquitination patterns might indicate disease progression

    • These biomarkers could help stratify patients for targeted interventions

  • Genetic Variation Analysis:

    • Identification of polymorphisms in RNF128 or its regulatory regions

    • Correlation of these variations with disease susceptibility or progression

    • This information could guide personalized risk assessment and preventive strategies

  • Pharmacogenomic Applications:

    • Development of companion diagnostics to identify patients likely to respond to RNF128-targeted therapies

    • Screening for genetic modifiers that influence therapeutic efficacy

    • This approach would enhance the precision of targeted treatments

  • Cell-Type Specific Therapeutics:

    • The macrophage-specific expression of RNF128 in atherosclerotic plaques provides an opportunity for cell-targeted therapies

    • Macrophage-directed drug delivery systems could enhance efficacy while reducing systemic side effects

    • This strategy aligns with the trend toward cell-type specific interventions in complex diseases

  • Combination Therapy Optimization:

    • Understanding how RNF128 interacts with established therapeutic targets (like lipid-lowering medications)

    • Identifying synergistic combinations that address multiple aspects of disease pathology

    • This integrated approach could maximize therapeutic efficacy for individual patients

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.