Recombinant Bovine Elongation of very long chain fatty acids protein 7 (ELOVL7)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7)

Recombinant Bovine Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7) is a protein involved in the elongation of fatty acids, particularly very long-chain fatty acids. This enzyme plays a crucial role in lipid metabolism by extending the carbon chain of fatty acids, which is essential for various biological processes. ELOVL7 is part of the ELOVL family of enzymes, which are responsible for the elongation of fatty acids in both saturated and unsaturated forms.

Biological Function of ELOVL7

ELOVL7 is known to participate in the elongation of fatty acids with up to 24 carbon atoms, particularly those with 18-carbon chains . It has been shown to influence the composition of fatty acids in cells by altering the levels of specific unsaturated fatty acids. For instance, in goat mammary epithelial cells, overexpression of ELOVL7 led to increased concentrations of vaccenic acid (C18:1n7) and linoleic acid (C18:2), while decreasing palmitoleic acid (C16:1n7) and oleic acid (C18:1n9) .

Role in Fatty Acid Synthesis

ELOVL7's role in fatty acid synthesis is critical, as it affects the elongation of unsaturated fatty acids. Studies have demonstrated that ELOVL7 exhibits high activity towards acyl-CoAs with 18-carbon chain lengths . This specificity is important for the regulation of lipid metabolism in various tissues.

Expression and Regulation

The expression of ELOVL7 is regulated by key pathways such as the sterol regulatory element-binding transcription factor 1 (SREBP1) and the mammalian target of rapamycin (mTOR) pathways . These pathways are crucial for lipid homeostasis and cellular metabolism.

Clinical Implications

Beyond its role in lipid metabolism, ELOVL7 has been implicated in predicting liver fibrosis and inflammation. Elevated ELOVL7 expression is associated with advanced liver fibrosis, suggesting its potential as a biomarker for liver disease .

Table 1: Effects of ELOVL7 Overexpression on Fatty Acid Composition

Fatty AcidChange with ELOVL7 Overexpression
C16:1n7Decreased
C18:1n9Decreased
C18:1n7Increased
C18:2Increased
C16:0No significant change
C18:0No significant change

Table 2: Predictive Performance of ELOVL7 for Liver Fibrosis

MetricValue for Liver Fibrosis S ≥ 2
AUC0.9
Specificity0.87
Sensitivity0.79
Positive Predictive Value (PPV)0.81
Negative Predictive Value (NPV)0.86

References

  1. Fatty Acid Elongase 7 (ELOVL7) Plays a Role in the Synthesis of Long-Chain Unsaturated Fatty Acids in Goat Mammary Epithelial Cells. PMC6616409.

  2. Elongation of Very Long Chain Fatty Acids Protein 7 (ELOVL7). The SGC.

  3. ELOVL Fatty Acid Elongase 7 (ELOVL7), Upregulated by Mdr2-Knockout. European Review.

  4. The Structural Basis of Fatty Acid Elongation by the ELOVL Elongases. PubMed.

  5. ELOVL7 ELOVL Fatty Acid Elongase 7 [Homo sapiens (human)]. NCBI Gene.

  6. The Structural Basis of Fatty Acid Elongation by the ELOVL Elongases. bioRxiv.

  7. ELOVL7 Gene - ELOVL Fatty Acid Elongase 7. GeneCards.

  8. Elongation of Very Long Chain Fatty Acids Protein 7. EMBL-EBI.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ELOVL7; Elongation of very long chain fatty acids protein 7; 3-keto acyl-CoA synthase ELOVL7; ELOVL fatty acid elongase 7; ELOVL FA elongase 7; Very long chain 3-ketoacyl-CoA synthase 7; Very long chain 3-oxoacyl-CoA synthase 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
ELOVL7
Target Protein Sequence
MAFSDLTSRTVRLYDNWIKDADPRVEDWLLMSSPLPQTIILGFYVYFVTSLGPKLMENRK PFELKKVMITYNFSIVLFSVYMFYEFIMSGWGTGYSFRCDIVDYSQSPTALRMVRTCWLY YFSKFIELLDTIFFILRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHAFLNTAV HVVMYSYYGLCALGPDYQKYLWWKKYLTSLQLIQFVLITIHISQFFFMEDCKYQFPVFQY IIMSYGCIFLLLFLHFWYRAYTKGQRLPKTVKHGICKNKDH
Uniprot No.

Target Background

Function
This recombinant bovine Elongation of very long chain fatty acids protein 7 (ELOVL7) catalyzes the rate-limiting, initial step in the four-reaction long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme adds two carbons per cycle to the chains of long- and very-long-chain fatty acids (VLCFAs). It exhibits higher activity towards C18 acyl-CoAs, particularly C18:3(n-3) and C18:3(n-6) acyl-CoAs. Additional activity is observed with C20:4-, C18:0-, C18:1-, C18:2-, and C16:0-CoAs, with minimal activity toward C22:0-, C24:0-, or C26:0-CoAs. ELOVL7 likely participates in saturated and polyunsaturated VLCFA production across various chain lengths. These VLCFAs serve as precursors for membrane lipids and lipid mediators, playing crucial roles in diverse biological processes.
Database Links
Protein Families
ELO family, ELOVL7 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of bovine ELOVL7 protein?

Bovine ELOVL7, like its human counterpart, is expected to contain seven transmembrane (TM) helices with TM2-7 forming a six TM inverted barrel structure surrounding a narrow tunnel approximately 35 Å in length . This tunnel houses the substrate binding sites and contains an active site deep within the membrane. The protein structure includes two units of three helices (TM2-4 and TM5-7), each forming an antiparallel three-helix arrangement, with the two units assembled as an inverted repeat around the central tunnel . TM1 lies outside the barrel against TM3/4. This unique fold differs from the GPCR 7TM fold and represents a distinctive structural arrangement among transmembrane proteins .

What is the primary function of bovine ELOVL7 in fatty acid metabolism?

Bovine ELOVL7 functions as a 3-keto acyl-CoA synthase that catalyzes the first, rate-limiting step in the fatty acid elongation cycle . This enzyme specifically elongates fatty acids with 12 or more carbons per chain, playing a crucial role in the biosynthesis of long-chain fatty acids (LCFAs, 12C-20C) and very long-chain fatty acids (VLCFAs, >20C) . Research suggests that ELOVL7 preferentially participates in the elongation of saturated very-long-chain fatty acids (SVLFAs, C20:0 and longer) . These fatty acids serve as essential precursors for the synthesis of ceramides, sphingolipids, and sphingolipid signaling molecules that are vital for various physiological functions .

In which tissues is bovine ELOVL7 primarily expressed?

While the search results don't specifically address bovine ELOVL7 tissue expression, comparative studies in other mammals suggest that ELOVL7 expression patterns may be tissue-specific and developmentally regulated. In goats, for instance, ELOVL7 shows differential expression in mammary tissue during lactation stages, with the highest expression observed during the dry period compared to peak and late lactation periods . Additionally, human studies have shown ELOVL7 overexpression in prostate cancer cells , and elevated expression in activated hepatic stellate cells associated with liver fibrosis . Bovine ELOVL7 expression patterns would likely include mammary tissue, liver, and potentially prostate tissue, though specific expression profiles would require direct experimental verification.

What methods are most effective for purifying recombinant bovine ELOVL7 while maintaining its activity?

Purification of recombinant bovine ELOVL7 presents significant challenges due to its seven transmembrane domain structure. Based on structural studies of human ELOVL7, effective purification protocols would likely involve expression in a mammalian or insect cell system rather than bacterial systems to ensure proper protein folding and post-translational modifications . The purification method would typically include cell membrane isolation, solubilization using mild detergents (such as digitonin, GDN, or LMNG), and affinity chromatography using epitope tags positioned to avoid interference with the protein's active site.

To maintain enzymatic activity, it's critical to preserve the native lipid environment or reconstitute the protein into lipid nanodiscs or liposomes after purification. Activity assays should be conducted to verify that the purified recombinant protein retains its catalytic function, using appropriate fatty acyl-CoA substrates and malonyl-CoA for the elongation reaction. The presence of the catalytic histidine residues in the canonical HxxHH motif should be confirmed, as these are essential for the enzyme's activity .

How can researchers effectively measure ELOVL7 enzymatic activity in vitro?

In vitro assessment of bovine ELOVL7 activity can be performed using fatty acid elongation assays. Based on previously established methodologies, researchers typically incubate the purified recombinant enzyme or microsomes containing ELOVL7 with appropriate fatty acyl-CoA substrates (such as C18:0-CoA, C20:0-CoA), malonyl-CoA (the two-carbon donor), NADPH, and necessary cofactors . The reaction products can be analyzed using gas chromatography-mass spectrometry (GC-MS) or liquid chromatography-mass spectrometry (LC-MS) techniques to quantify the elongated fatty acids.

For comprehensive analysis, researchers should examine both the substrate consumption and product formation rates. Additionally, fatty acid composition analysis of phospholipids and neutral lipids (such as cholesterol esters) can provide insights into the specific lipid pools affected by ELOVL7 activity . The elongation indices, calculated as the ratio of product to substrate (e.g., C18:0/C16:0 or C18:1/C16:1), serve as useful metrics for evaluating ELOVL7's elongation capacity for different fatty acid substrates .

What are the structural mechanisms underlying substrate specificity in bovine ELOVL7?

The substrate specificity of bovine ELOVL7 is likely determined by the architecture of its substrate-binding tunnel, similar to human ELOVL7 . Structural studies of human ELOVL7 reveal a 35 Å long tunnel within the transmembrane domain that accommodates the fatty acyl chain, with specific residues lining this tunnel contributing to substrate recognition and binding . The active site, located deep within the membrane and containing the canonical HxxHH motif, plays a crucial role in the condensation reaction mechanism.

Molecular modeling and site-directed mutagenesis experiments targeting residues lining the substrate tunnel would be essential for identifying the specific amino acids that determine substrate preference in bovine ELOVL7. Analysis of the reaction mechanism suggests that elongation proceeds via an acyl-enzyme intermediate involving the second histidine in the HxxHH motif . Understanding the precise interactions between the enzyme and various fatty acyl-CoA substrates would provide insights into the structural basis of substrate specificity and potentially enable rational design of selective inhibitors or substrate analogues.

How do post-translational modifications affect ELOVL7 activity and stability?

While the search results don't specifically address post-translational modifications of ELOVL7, research on membrane-bound enzymes suggests that modifications such as phosphorylation, glycosylation, and palmitoylation could potentially modulate ELOVL7 activity, stability, and subcellular localization. Investigating these modifications in bovine ELOVL7 would require mass spectrometry-based proteomic approaches to identify modification sites, followed by site-directed mutagenesis to assess their functional significance.

Key experiments would include comparing the modification patterns of ELOVL7 across different tissue types and physiological states, analyzing how these modifications correlate with enzymatic activity, and examining the signaling pathways that regulate these modifications. Phosphoproteomic analysis could reveal potential regulatory phosphorylation sites, while glycoproteomic studies might identify glycosylation patterns that influence protein stability or trafficking. Comparing bovine ELOVL7 modifications with those in other species could also provide evolutionary insights into conserved regulatory mechanisms.

What role does ELOVL7 play in bovine mammary gland development and milk fat synthesis?

Based on studies in goat mammary tissue, bovine ELOVL7 likely plays a significant role in mammary gland development and milk fat synthesis. Research has shown that ELOVL7 expression in goat mammary tissue varies across lactation stages, with the highest expression observed during the dry period compared to peak and late lactation periods . This suggests a developmentally regulated pattern that may be similar in bovine mammary tissue.

In goat mammary epithelial cells, ELOVL7 overexpression resulted in decreased concentrations of palmitoleic (C16:1n7) and oleic (C18:1n9) acids, while increasing the concentrations of vaccenic (C18:1n7) and linoleic (C18:2) acids . ELOVL7 overexpression also significantly upregulated the elongation index of C16:1, indicating its involvement in unsaturated fatty acid metabolism . These findings suggest that bovine ELOVL7 may similarly influence milk fatty acid composition by modulating the elongation of specific fatty acid substrates.

Research approaches to investigate bovine ELOVL7's role in mammary function should include analyzing its expression patterns throughout lactation cycles, assessing the impact of ELOVL7 manipulation on milk fat composition, and exploring its interactions with other mammary lipogenic enzymes such as SCD1 (Stearoyl-CoA desaturase 1) and DGAT2 (Diacylglycerol O-acyltransferase 2) .

How is ELOVL7 involved in bovine liver diseases and metabolism?

Based on human and rodent studies, bovine ELOVL7 may play a significant role in liver diseases and metabolism. Research has demonstrated that ELOVL7 expression is significantly elevated in liver fibrosis, with expression levels positively correlating with fibrosis staging . ELOVL7 has shown excellent predictive performance for advanced liver fibrosis (S ≥ 2) and inflammation (G ≥ 2), suggesting its potential as a biomarker for liver disease progression .

The mechanism underlying ELOVL7's involvement in liver pathology appears to involve hepatic stellate cell (HSC) activation and TGFβ signaling pathways. Studies have shown positive correlations between ELOVL7 expression and TGFβ1, TGFβ2, and TGFβ3 expression, indicating that ELOVL7 may participate in the activation of the TGFβ signaling pathway during liver fibrogenesis . Additionally, protein-protein interaction analysis revealed significant associations between ELOVL7 and pathways related to fatty acid metabolism, biosynthesis of unsaturated fatty acids, and fatty acid elongation .

Research approaches to investigate bovine ELOVL7's role in liver function should include comparative expression analyses in healthy versus diseased bovine liver tissues, assessment of ELOVL7's impact on hepatic lipid composition, and exploration of its interactions with key signaling pathways involved in liver fibrosis and inflammation.

What is the relationship between ELOVL7 function and bovine metabolic disorders?

While specific information about bovine ELOVL7 and metabolic disorders isn't provided in the search results, extrapolation from human and mouse studies suggests potential involvement in metabolic regulation. Human studies have implicated ELOVL family proteins in conditions like insulin resistance and hepatic steatosis , indicating that bovine ELOVL7 might similarly influence metabolic health.

The mechanism likely involves ELOVL7's role in synthesizing very long-chain fatty acids (VLCFAs) that serve as precursors for bioactive lipid species like ceramides and sphingolipids . These lipid molecules act as signaling mediators that can influence insulin sensitivity, inflammation, and lipid accumulation in tissues. Additionally, alterations in membrane lipid composition due to changes in ELOVL7 activity could affect membrane fluidity and consequently impact the function of membrane-bound receptors and transporters involved in metabolic regulation.

Research approaches to investigate bovine ELOVL7's role in metabolic disorders should include analyzing its expression and activity in metabolically relevant tissues (liver, adipose, muscle, pancreas) under normal versus metabolically challenged conditions, assessing the impact of ELOVL7 manipulation on insulin signaling pathways, and exploring correlations between ELOVL7 variants and metabolic traits in bovine populations.

What are the key transcriptional regulators of bovine ELOVL7 expression?

While specific information about bovine ELOVL7 transcriptional regulation isn't provided in the search results, insights from other species suggest several potential regulatory mechanisms. In prostate cancer cells, ELOVL7 expression is regulated by the androgen pathway through sterol regulatory element-binding protein 1 (SREBP1) , a master regulator of lipogenic gene expression. This suggests that hormonal and nutritional factors that activate SREBP1 might similarly regulate bovine ELOVL7.

The differential expression of ELOVL7 across lactation stages in goat mammary tissue indicates developmental and physiological regulation that likely involves lactogenic hormones (prolactin, insulin, cortisol) and potentially milk removal signals. Additionally, the elevated expression of ELOVL7 in liver fibrosis contexts suggests that inflammatory and fibrogenic signals, particularly those in the TGFβ pathway, may regulate its expression .

Research approaches to identify bovine ELOVL7 transcriptional regulators should include promoter analysis to identify potential binding sites for transcription factors, chromatin immunoprecipitation (ChIP) experiments to confirm direct binding, reporter gene assays to evaluate promoter activity under various conditions, and analysis of ELOVL7 expression in response to specific signaling pathway activators or inhibitors.

How do various experimental conditions affect ELOVL7 expression and activity in bovine cell culture models?

Based on studies in other species, several experimental conditions would likely influence bovine ELOVL7 expression and activity in cell culture models. Hormonal treatments, particularly those involving androgens and insulin, might modulate ELOVL7 expression through SREBP1 activation . Inflammatory cytokines, especially those in the TGFβ family, could upregulate ELOVL7 expression, as suggested by the positive correlation between ELOVL7 and TGFβ signaling in liver fibrosis studies .

Nutritional factors, particularly fatty acid availability, would likely influence ELOVL7 activity and possibly its expression. Studies in goat mammary epithelial cells have shown that manipulation of ELOVL7 levels affects the concentrations of specific fatty acids , suggesting a dynamic relationship between substrate availability and enzyme function. Additionally, cellular stress conditions, such as hypoxia or endoplasmic reticulum stress, might impact ELOVL7 expression as part of the cellular adaptive response.

Research approaches should include systematic evaluation of ELOVL7 expression and activity under various treatment conditions in relevant bovine cell types (mammary epithelial cells, hepatocytes, adipocytes), time-course experiments to distinguish between acute and chronic effects, and analyses of both mRNA and protein levels to account for post-transcriptional regulation.

What experimental techniques are most effective for studying ELOVL7 protein-protein interactions?

Investigating ELOVL7 protein-protein interactions requires specialized approaches due to its multi-spanning transmembrane structure. Effective techniques would include proximity-based labeling methods such as BioID or APEX, which involve expressing ELOVL7 fused to a biotin ligase or peroxidase that biotinylates nearby proteins, allowing subsequent purification and identification of interaction partners by mass spectrometry .

Co-immunoprecipitation using mild detergents that preserve membrane protein complexes, followed by mass spectrometry analysis, can also reveal stable interaction partners. For direct physical interactions, membrane yeast two-hybrid systems or split ubiquitin assays are more suitable than conventional yeast two-hybrid methods for membrane proteins like ELOVL7.

Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) techniques can validate specific interactions in living cells, while protein fragment complementation assays provide additional options for detecting interactions in cellular contexts. Computational prediction of protein-protein interactions based on structural data can guide experimental designs by identifying potential interaction interfaces. Based on insights from protein-protein interaction analyses, ELOVL7 interacts with other proteins involved in fatty acid metabolism, fatty acyl-CoA biosynthesis, and metabolic pathways , making these pathways particularly relevant for interaction studies.

How does bovine ELOVL7 differ structurally and functionally from ELOVL7 in other species?

Functionally, ELOVL7 appears to play species-specific roles in fatty acid metabolism. In goat mammary epithelial cells, ELOVL7 influences the elongation of unsaturated fatty acids, affecting the concentrations of palmitoleic, oleic, vaccenic, and linoleic acids . This suggests a role in milk fat synthesis that might be particularly relevant to ruminants like cattle. In contrast, human studies have highlighted ELOVL7's preference for saturated very-long-chain fatty acids (SVLFAs) and its implications in diseases like prostate cancer .

Research approaches to compare bovine ELOVL7 with other species should include sequence and structural analyses to identify conserved and divergent regions, comparative enzymatic assays using recombinant proteins from different species, and functional studies in species-specific cell types to elucidate context-dependent roles.

How does bovine ELOVL7 functionally relate to other members of the ELOVL family?

Bovine ELOVL7 is expected to be one of seven ELOVL family members (ELOVL1-7), each with distinct but potentially overlapping substrate preferences and tissue expression patterns . Based on studies in other species, ELOVL7 likely specializes in elongating specific fatty acid substrates while functioning within a broader network of fatty acid elongation enzymes.

The functional relationships among ELOVL family members involve both complementary and potentially compensatory activities. Different ELOVLs may elongate distinct subsets of fatty acids or operate predominantly in specific tissues or developmental stages. For instance, while ELOVL7 shows a preference for saturated very-long-chain fatty acids in some contexts , it also influences unsaturated fatty acid metabolism in mammary epithelial cells , suggesting context-dependent substrate preferences that may complement other ELOVL family members.

Research approaches to understand the functional relationships between bovine ELOVL7 and other ELOVL family members should include comparative expression analyses across tissues and developmental stages, enzymatic assays to define substrate specificity profiles, co-expression studies to identify coordinated regulation, and loss-of-function experiments to assess potential functional redundancy or compensation among family members.

What evolutionary pressures have shaped ELOVL7 function in agricultural species compared to non-domesticated animals?

While not directly addressed in the search results, evolutionary analysis of ELOVL7 across agricultural and non-domesticated species would provide valuable insights into functional adaptations related to domestication and selective breeding. In agricultural species like cattle, selective pressures related to milk production, meat quality, and metabolic efficiency may have influenced ELOVL7 evolution.

For dairy cattle, evolutionary adaptations in ELOVL7 might enhance its role in mammary gland fatty acid metabolism, potentially optimizing milk fat composition for calf nutrition or human consumption. The differential expression of ELOVL7 during lactation stages in goats suggests regulatory adaptations that coordinate its activity with the physiological demands of milk production.

Research approaches to investigate evolutionary aspects of ELOVL7 should include phylogenetic analyses across diverse mammalian species, identification of signatures of positive selection in coding and regulatory regions, comparative analysis of ELOVL7 variants in primitive versus highly selected cattle breeds, and functional characterization of species-specific variants to determine their phenotypic consequences. Additionally, examination of ELOVL7 polymorphisms in relation to production traits could reveal how genetic variation in this gene contributes to phenotypic diversity in agricultural species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.