Recombinant Bovine Endothelin B receptor-like protein 2 (GPR37L1)

Shipped with Ice Packs
In Stock

Description

Production Methods

Recombinant bovine GPR37L1 is engineered for high yield and specificity:

ParameterDetail
Host SystemCell-free expression or HEK-293 cells
Purification MethodAffinity chromatography (e.g., GST-tagged purification)
ReactivitySpecific to bovine tissues
Purity≥85% (SDS-PAGE verified)
ApplicationsELISA, Western blotting, immunohistochemistry, ligand-binding assays

Functional Roles

GPR37L1 is implicated in diverse physiological processes:

  • Neurological Regulation: Modulates cerebellar development, Bergmann glia maturation, and glutamate homeostasis .

  • Cardiovascular Control: Regulates blood pressure homeostasis via central mechanisms .

  • Neuroprotection: Binds prosaposin/prosaptide to reduce oxidative stress in astrocytes .

  • Epilepsy and Migraine: Rare variants correlate with progressive myoclonus epilepsy and migraine .

Signaling Pathways and Ligand Interactions

  • Prosaposin/Prosaptide Binding: Activates Gαi-mediated pathways, inhibiting cAMP (EC₅₀ ~10 nM) and phosphorylating ERK1/2 .

  • Syntenin-1 Interaction: Enhances plasma membrane trafficking by 10-fold in heterologous systems .

  • Ion Transport: Regulates renal sodium reabsorption, linking to hypertension mechanisms .

Functional Assays

Assay TypeResult
ELISA Detection Range0.156–10 ng/mL (sensitivity: 0.1 ng/mL)
ERK PhosphorylationInduced by prosaptide in HEK-293 cells (PTX-sensitive)
Surface Expression<1% for wild-type vs. 25% for N-terminal truncated mutants

Potential Applications

  • Diagnostic Tools: Commercial ELISA kits enable GPR37L1 quantification in serum, plasma, and tissues .

  • Therapeutic Targets:

    • Neurodegenerative diseases (e.g., Parkinson’s) .

    • Hypertension and cardiovascular disorders .

    • Epilepsy and migraine prophylaxis .

  • Drug Discovery: High-purity recombinant protein supports ligand screening and structural studies .

Challenges and Future Directions

  • Expression Limitations: Poor native trafficking necessitates truncation or co-expression with syntenin-1 for functional studies .

  • Ligand Specificity: Despite prosaposin pairing, endogenous ligands in peripheral tissues remain unconfirmed .

  • Species-Specific Variations: Functional differences between bovine and human isoforms require further characterization .

Future research should prioritize crystallography to resolve bovine GPR37L1’s active-state structure and in vivo validation of its neuroprotective effects .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill them accordingly.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C, while the shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquotting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR37L1; ETBRLP2; G-protein coupled receptor 37-like 1; Endothelin B receptor-like protein 2; ETBR-LP-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
26-482
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
VWLQQGGHQPVAQEQPDRSRRGAEREDAKGLQQYVPEGWAEYPRPIRPAALQPTQPWVAA SPSPDRARATGGSGQEPQGNVTGPPGQRPQVQNPLYPVTERSYGAYAVLLLALLLFAVGI VGSLAVMCIVWHSYYLKSAWNSVLASLALWDFLVLFFCLPVVTFHEITKQRLLGAVSCRA VPFVEVSSLGVTTFSLCALGIDRFHVATSTLPKARPIEPCPSILAKLAVIWVGSMTLAAP ELLLWQLVREPSPAAGTVDTCIMKPSAHLPESLYSLVLTYQNARMWWSFGCYFCLPVLFT VTCQLVTWRVRGTPGRKPESRPGPQEPRGARPSSTVAGLAAVHALCALPENVCNVVAAYL SAALTRQTLELLGLVTQFSTFFKAALTPLLLLCVSRPLGRAFLDCCCCCCGEGCGEGCGG RAAPAGPRAKLHTELSASGYFHKPREAPPLLALGTPC
Uniprot No.

Target Background

Function
G-protein coupled receptor. Studies have demonstrated that GPR37L1 binds the neuroprotective and glioprotective factor prosaposin (PSAP), leading to endocytosis and subsequent ERK phosphorylation cascade activation. However, other studies have suggested that prosaposin does not enhance activity. It has been proposed that GPR37L1 is a constitutively active receptor that signals through the guanine nucleotide-binding protein G(s) subunit alpha. GPR37L1 plays a role in the regulation of postnatal cerebellar development by modulating the Shh pathway. It also regulates baseline blood pressure in females and provides protection against cardiovascular stress in males. Furthermore, GPR37L1 mediates the inhibition of astrocyte glutamate transporters and reduces neuronal N-methyl-D-aspartate receptor activity.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, cilium membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.