Recombinant Bovine ephemeral fever virus Glycoprotein G (G)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
G; Glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-623
Protein Length
Full Length of Mature Protein
Species
Bovine ephemeral fever virus (strain BB7721) (BEFV)
Target Names
G
Target Protein Sequence
KIHLEKIYNVPVNCGELHPVKAHEIKCPQRLNELSLQAHHNLAKDEHYNKICRPQLKDDA HLEGFICRKQRWITKCSETWYFSTSIEYQILEVIPEYSGCTDAVKKLDQGALIPPYYPPA GCFWNTEMNQEIEFYVLIQHKPFLNPYDNLIYDSRFLTPCTINDSKTKGCPLKDITGTWI PDVRVEEISEHCNNKHWECITVKSFRSELNDKERLWEAPDIGLVHVNKGCLSTFCGKNGI IFEDGEWWSIENQTESDFQNFKIEKCKGKKPGFRMHTDRTEFEELDIKAELEHERCLNTI SKILNKENINTLDMSYLAPTRPGRDYAYLFEQTSWQEKLCLSLPDSGRVSKDCNIDWRTS TRGGMVKKNHYGIGSYKRAWCEYRPFVDKNEDGYIDIQELNGHNMSGNHAILETAPAGGS SGNRLNVTLNGMIFVEPTKLYLHTKSLYEGIEDYQKLIKFEVMEYDNVEENLIRYEEDEK FKPVNLNPHEKSQINRTDIVREIQKGGKKVLSAVVGWFTSTAKAVRWTIWAVGAIVTTYA IYKLYKMVKSNSSHSKHREADLEGLQSTTKENMRVEKNDKNYQDLELGLYEEIRSIKGGS KQTGDDRFFDH
Uniprot No.

Target Background

Function
This glycoprotein mediates viral attachment to host cell receptors, triggering virion endocytosis. The ensuing low pH environment within the endosome induces conformational changes in the glycoprotein trimer, ultimately leading to fusion between the viral and cellular membranes.
Gene References Into Functions
  1. The highly protective nature of native BEFV G and GNS proteins suggests their potential as effective vaccine antigens. PMID: 18626567
Database Links

KEGG: vg:911729

Protein Families
Rhabdoviruses glycoprotein family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is Bovine Ephemeral Fever Virus and its glycoprotein G?

Bovine ephemeral fever (BEF) is caused by an arthropod-borne virus belonging to the family Rhabdoviridae and genus Ephemerovirus. The virus causes acute febrile infection in cattle and water buffalo, often resulting in significant economic losses to the livestock industry. The BEFV genome encodes two major glycoproteins: G and G(NS). The G glycoprotein, with an approximate molecular mass of 79-80 kDa, serves as the primary surface antigen that induces neutralizing antibodies and is crucial for viral entry and cell-to-cell spread .

How does BEFV G differ from BEFV G(NS) in structure and function?

Though BEFV encodes both G and G(NS) glycoproteins, they differ significantly in their molecular characteristics and functional roles:

CharacteristicBEFV G ProteinBEFV G(NS) Protein
Molecular Mass~79 kDa (recombinant), slightly smaller than native~90 kDa (both native and recombinant)
Antigenic SitesContains all defined neutralizing antigenic sites (G1, G2, G3a, G3b, G4)Does not react with anti-G protein monoclonal or polyclonal antibodies
Cellular LocalizationEndoplasmic reticulum/Golgi complex internally; associated with budding and mature virus particles at cell surfaceEndoplasmic reticulum/Golgi complex internally; associated with amorphous structures (not virions) at cell surface
Immunological RoleInduces neutralizing antibodies and provides protectionFails to induce neutralizing antibodies and doesn't confer protection

The recombinant G protein reacts with monoclonal antibodies directed against all defined neutralizing antigenic sites, while the G(NS) protein fails to react by immunofluorescence with anti-G protein monoclonal or polyclonal antibodies .

Why is BEFV G the primary target for recombinant vaccine development?

BEFV G protein is the preferred candidate for recombinant vaccine development because it alone is capable of inducing neutralizing antibodies and providing protection against experimental BEFV infection. Research has conclusively demonstrated that cattle vaccinated with recombinant vaccinia virus expressing BEFV G (rVV-G) produced neutralizing antibodies and were protected against experimental BEFV challenge. In contrast, cattle vaccinated with recombinant vaccinia virus expressing G(NS) (rVV-G(NS)) failed to produce neutralizing antibodies, and BEFV was isolated from two-thirds of these vaccinated cattle after challenge . This differential immune response makes G protein the logical target for vaccine development efforts.

What expression systems have been successfully used for recombinant BEFV G production?

Multiple expression platforms have been employed for recombinant BEFV G production, each with distinct advantages:

  • Newcastle Disease Virus (NDV) Vector: The recombinant NDV expressing BEFV G (rL-BEFV-G) was constructed by cloning the BEFV G gene ORF between the P and M genes of the NDV genome. This system offers advantages including ease of culture, growth to high titers in chicken eggs, and the ability to obtain high concentrations of virus from allantoic fluid .

  • Vaccinia Virus Vector: Recombinant vaccinia viruses expressing BEFV G (rVV-G) have been developed that produce G protein reacting with monoclonal antibodies against all defined neutralizing antigenic sites .

  • Mammalian Cell Expression Systems: BHK-21 cells have been used to express secreted forms of C-terminally truncated BEFV G (transmembrane anchoring region deleted). The V5 epitope tag can be genetically fused to the C-termini, enabling detection through immunoblotting and immunomicroscopy. This system allows for proper glycosylation and secretion of the protein into the cell media, facilitating simple purification methods .

How does the deletion of the transmembrane domain affect BEFV G expression and immunogenicity?

The strategic deletion of the transmembrane anchoring region of BEFV G creates C-terminally truncated forms that are efficiently secreted from mammalian cells into the culture media. This approach offers several advantages:

  • Enhanced Expression Levels: Secreted forms facilitate high-level antigen expression compared to membrane-bound forms.

  • Correct Glycosylation: When expressed in mammalian cells like BHK-21, these truncated forms maintain appropriate glycosylation patterns, which is crucial for immunogenicity.

  • Simplified Purification: The addition of epitope tags (such as V5) to secreted forms enables highly effective, single-step purification methods from the culture media.

  • Preserved Immunogenicity: Studies have confirmed that these truncated G glycoproteins retain their immunogenicity in mouse models .

This expression strategy represents a feasible approach for large-scale production of high-quality recombinant protein for vaccine development while potentially reducing the amount of antigen required in the final vaccine formulation .

What functional changes occur when BEFV G is expressed in heterologous viral vectors?

When BEFV G is expressed in heterologous viral vectors, it can significantly alter the biological properties of the vector virus. A notable example is the expression of BEFV G in Newcastle disease virus (NDV):

What are the neutralizing antibody responses elicited by different recombinant BEFV G vaccines?

Different recombinant BEFV G vaccines induce varying levels of neutralizing antibody responses:

  • rL-BEFV-G (NDV Vector): This recombinant vaccine induced neutralizing antibody titers of approximately 1:388 in mice and 1:64-128 in cattle. Higher titers (1:256 to 1:512) can potentially be achieved by increasing the inoculation dose .

  • rVV-G (Vaccinia Virus Vector): Vaccinia virus expressing BEFV G induced neutralizing antibody titers of approximately 1:100 after the second inoculation in cattle and provided protection against experimental BEFV infection .

  • LSDV-BEFV G (Lumpy Skin Disease Virus Vector): BEFV G vectored by the South African vaccine strain of lumpy skin disease virus induced neutralizing antibody and cellular immune responses, but provided unsatisfactory protection from virus challenge .

These comparative results suggest that while all recombinant vaccines can induce neutralizing antibodies, the NDV-vectored vaccine may offer advantages in terms of neutralizing antibody titers and practicality of production .

What diagnostic methods target the BEFV G gene for rapid virus detection?

The BEFV G gene serves as an ideal target for molecular diagnostic methods due to its specificity. Among the advanced diagnostic techniques developed:

  • Lateral-Flow Dipstick Isothermal Recombinase Polymerase Amplification (LFD-RPA): This method targets the specific G gene of BEFV. The amplification reaction is performed at 38°C for just 20 minutes, with lateral flow dipstick results visible to the naked eye within 5 minutes. This assay demonstrates high sensitivity (detection limit of 8 copies per reaction) and specificity (no cross-reactivity with other bovine infectious viruses including bovine viral diarrhea virus, infectious bovine rhinotracheitis virus, bovine respiratory syncytial virus, bovine coronavirus, bovine parainfluenza virus type 3, and bovine vesicular stomatitis virus) .

  • Performance Comparison: When tested with 128 clinical specimens, the LFD-RPA assay showed a 96.09% (123/128) coincidence rate with real-time quantitative PCR, which was higher than conventional RT-PCR. This suggests that RPA combined with LFD provides a rapid and sensitive alternative for diagnosing BEFV infections during outbreaks .

The G gene-targeted diagnostic methods offer substantial advantages for field applications, particularly in resource-limited settings where rapid detection is crucial for implementing timely control measures.

How can codon optimization enhance recombinant BEFV G expression?

Codon optimization represents a critical consideration in recombinant BEFV G expression. Recent research has examined codon usage bias patterns in BEFV genes including the G gene . For optimal expression of recombinant BEFV G:

  • Host-Specific Codon Optimization: Adapting the BEFV G gene codons to match the preferred codon usage of the expression host (whether bacterial, insect, or mammalian cells) can significantly enhance protein yields.

  • GC Content Adjustment: Modifying the GC content of the synthetic gene construct to match the optimal range for the expression system can improve transcriptional and translational efficiency.

  • Removal of Rare Codons: Eliminating rare codons or clusters of rare codons that might cause translational pausing or premature termination can enhance full-length protein production.

  • RNA Secondary Structure Consideration: Designing the codon-optimized sequence to minimize problematic RNA secondary structures, especially at the 5' end, can improve translation initiation efficiency.

Researchers should consider these factors when designing synthetic BEFV G genes to maximize expression levels in their chosen production system.

What are the critical quality control parameters for recombinant BEFV G production?

When producing recombinant BEFV G for research or vaccine development, several quality control parameters must be evaluated:

  • Immunoreactivity: The recombinant G protein should react with monoclonal antibodies directed against all defined neutralizing antigenic sites (G1, G2, G3a, G3b, and G4), confirming structural integrity of key epitopes .

  • Glycosylation Status: Proper glycosylation is crucial for immunogenicity. Techniques such as labeling with D-[6-3H]glucosamine or lectin binding assays can verify appropriate glycosylation .

  • Molecular Size Verification: Western blotting should confirm the expected molecular mass (approximately 79-80 kDa for recombinant G), with awareness that recombinant G may appear slightly smaller than native G protein .

  • Cellular Localization: For membrane-bound forms, immunofluorescence and immuno-electron microscopy should verify correct localization to the endoplasmic reticulum/Golgi complex internally and association with budding and mature virus particles at the cell surface .

  • Functional Activity: For vectored vaccines, cell-to-cell spread assays can confirm functional activity of the expressed G protein .

What challenges exist in scaling up recombinant BEFV G production for vaccine development?

Scaling up recombinant BEFV G production for vaccine development presents several challenges:

  • Expression System Selection: While NDV vectors offer advantages of high titers in eggs, mammalian cell expression systems may provide better glycosylation patterns. The choice involves balancing yield, authenticity, and production complexity .

  • Protein Stability: Maintaining stability of the G protein during purification and storage represents a significant challenge, especially for secreted forms. Optimization of buffer conditions and addition of stabilizers may be necessary.

  • Purification Efficiency: For secreted forms, while the addition of epitope tags enables single-step purification, optimizing this process for large-scale production while maintaining protein integrity requires careful method development .

  • Potency Standardization: Establishing consistent methods to measure antigen potency across production batches is essential for vaccine quality control.

  • Adjuvant Compatibility: Determining the optimal adjuvant formulation that enhances immune response while maintaining G protein stability poses additional challenges for vaccine formulation.

Addressing these challenges requires systematic optimization studies and potentially the development of novel technological approaches specific to BEFV G production.

How might structure-based design improve recombinant BEFV G vaccines?

Structure-based design represents a promising approach to enhance recombinant BEFV G vaccines:

  • Epitope Mapping and Enhancement: Detailed mapping of neutralizing epitopes could enable the design of constructs with optimized presentation of key antigenic sites G1, G2, G3a, G3b, and G4 .

  • Thermostability Engineering: Introduction of strategic mutations or disulfide bonds could enhance the thermostability of recombinant G protein, potentially eliminating cold chain requirements.

  • Multi-Epitope Constructs: Development of chimeric proteins combining multiple protective epitopes from G protein could potentially enhance immunogenicity while reducing production complexity.

  • Structure-Guided Truncation: Precise structural knowledge could guide the development of minimal constructs retaining all neutralizing epitopes while eliminating non-essential regions, potentially improving expression efficiency.

  • Nanoparticle Display Platforms: Presenting recombinant G or its epitopes on self-assembling nanoparticles could enhance immunogenicity through multivalent display.

What are the prospects for cross-protective BEFV vaccines using conserved G protein domains?

Developing cross-protective BEFV vaccines utilizing conserved G protein domains offers potential advantages:

  • Strain Variation Analysis: Comprehensive analysis of G protein sequences across BEFV isolates would identify highly conserved regions containing neutralizing epitopes.

  • Consensus Sequence Approach: Construction of a consensus G protein sequence representing multiple BEFV strains could potentially induce broader protection.

  • Conserved Epitope Focus: Vaccine designs focusing specifically on confirmed neutralizing epitopes with high conservation might provide broader protection against variant strains.

  • Computational Epitope Prediction: Advanced bioinformatics approaches could identify conserved epitopes that might not be immunodominant in natural infection but could induce protective immunity if properly presented.

  • Universal Vaccine Platforms: Integration of conserved G protein epitopes into universal vaccine platforms might enhance cross-protective potential.

This approach could address the challenges posed by BEFV strain variation and potentially lead to more broadly protective vaccines.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.