Recombinant Bovine Estradiol 17-beta-dehydrogenase 12 (HSD17B12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HSD17B12; Very-long-chain 3-oxoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12; 17-beta-HSD 12; 3-ketoacyl-CoA reductase; KAR; Estradiol 17-beta-dehydrogenase 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-312
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
HSD17B12
Target Protein Sequence
METALPAAGFLYWVGASTVAYLALRISCWFFTALRVWGLGHEAGVGPWLGEWAVVTGGTD GIGKSYAEELAKRGMKIVLISRSQDKLDQVSSEISEKFKVETKTIAVDFTSEDIYDKIKA SLAGLNIGVLVNNVGMSYEYPEYFLDVPDLDNTIKKLITVNALSVCKMTRLVLPGMVERS KGAILNISSASGMYPVPLLTIYSATKAFVDFFSQCLHEEYKSKGVIVQSVLPYYVATKLA KIKRPTWDKPSPETFVKSAMKTIGVQSRTNGYPIHSLVASVSASLPSWLYFKIAMYSGNS IRVRYLKKMKMN
Uniprot No.

Target Background

Function

Recombinant Bovine Estradiol 17-beta-dehydrogenase 12 (HSD17B12) catalyzes the second step in the four-step long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzyme facilitates the addition of two carbons to long- and very long-chain fatty acids (VLCFAs) per cycle. Specifically, HSD17B12 exhibits 3-ketoacyl-CoA reductase activity, reducing 3-ketoacyl-CoA to 3-hydroxyacyl-CoA in each elongation cycle. This function contributes to the biosynthesis of VLCFAs with varying chain lengths, which serve as precursors for membrane lipids and lipid mediators. Additionally, HSD17B12 may catalyze estrone (E1) to estradiol (E2) conversion, playing a role in estrogen production.

Database Links

UniGene: Bt.104048

Protein Families
Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of HSD17B12 in bovine tissues?

HSD17B12 serves dual critical functions in bovine tissues. Primarily, it functions as a 17beta-hydroxysteroid dehydrogenase that converts estrone into estradiol in ovarian tissue, playing a key role in steroid hormone biosynthesis. Additionally, this enzyme is integrally involved in fatty acid elongation pathways, particularly for very long chain fatty acids . This dual functionality makes HSD17B12 central to both reproductive endocrinology and lipid metabolism in bovine systems. Studies with knockout models demonstrate that HSD17B12 is essential for maintaining proper lipid homeostasis, as its absence rapidly leads to severe metabolic disruptions .

Where is HSD17B12 primarily expressed in bovine tissues?

While comprehensive bovine-specific expression data is limited in the provided search results, research in mammalian models indicates that HSD17B12 is expressed across multiple tissues with particularly high expression in lipid-rich tissues. In mouse models, high expression was noted in adipose tissue . By extension to bovine systems, we would expect significant expression in ovarian tissue (consistent with its role in estradiol production), adipose deposits, mammary tissue, and liver—organs central to lipid metabolism and steroid hormone processing. The enzyme is predicted to be active primarily in the endoplasmic reticulum , which aligns with its role in lipid biosynthesis pathways.

How does bovine HSD17B12 compare structurally to human and murine orthologs?

Bovine HSD17B12 is orthologous to human HSD17B12, with conserved functional domains for both steroid conversion and fatty acid elongation activities. The gene is located on chromosome 11p11.2 in humans and contains 18 exons . While the search results don't provide specific sequence homology percentages between bovine, human, and murine versions, the functional conservation is evidenced by cross-species experimental findings. For example, studies demonstrate that the enzyme in various species catalyzes the same biochemical reactions—conversion of estrone to estradiol and participation in fatty acid elongation pathways . This structural conservation facilitates translational research where findings from one species can inform understanding of the enzyme's function in others.

What regulatory factors influence HSD17B12 expression in bovine mammary epithelial cells?

Several hormonal and environmental factors regulate HSD17B12 expression in bovine mammary epithelial cells (bMECs). Experimental evidence indicates that 17beta-estradiol can both increase and decrease HSD17B12 expression, suggesting complex regulatory mechanisms that may depend on specific cellular contexts or additional signaling factors . Prolactin, when combined with estradiol, acts as an epigenetic modulator in bMECs, particularly during infectious challenges such as Staphylococcus aureus infection . Additionally, various chemical compounds including 1,2-dichloroethane, 1,2-dimethylhydrazine, and 17alpha-ethynylestradiol have been shown to affect HSD17B12 expression levels . These complex regulatory patterns highlight the enzyme's responsiveness to both endogenous hormonal signals and exogenous chemical exposures.

How does HSD17B12 knockout affect lipid profiles and inflammatory responses in model systems?

Conditional knockout of HSD17B12 produces profound effects on lipid metabolism and triggers significant inflammatory responses. In mouse models with tamoxifen-induced HSD17B12 knockout, researchers observed:

ParameterMale ResponseFemale Response
Body weight loss20% within 6 days20% within 6 days
White fat reduction83%75%
Brown fat reduction65%60%
Serum ALT increase4.6-fold7.7-fold
Hepatic changesPresentMore pronounced

What are the sex-specific differences in HSD17B12 function and how should researchers account for these in experimental design?

Research on HSD17B12 knockout models reveals significant sex-specific differences that researchers must consider when designing experiments. Female mice exhibited more pronounced hepatic changes compared to males following HSD17B12 inactivation, with higher increases in serum alanine aminotransferase (7.7-fold in females versus 4.6-fold in males) . This suggests greater liver sensitivity to HSD17B12 deficiency in females. Additionally, while both sexes experienced dramatic fat loss, the percentage reduction varied (white fat: 83% in males versus 75% in females; brown fat: 65% in males versus 60% in females) .

For rigorous experimental design, researchers should:

  • Include balanced groups of male and female subjects in all studies

  • Analyze and report data separately by sex

  • Consider hormonal status (estrous/menstrual cycle, pregnancy, lactation) as variables

  • Investigate potential interactions between HSD17B12 and sex-specific hormonal environments

  • Examine tissue-specific expression patterns across sexes

  • Consider potential differences in compensatory mechanisms between sexes

These sex-specific differences likely reflect the enzyme's dual role in both fatty acid metabolism and estrogen biosynthesis, with the latter being particularly relevant to female reproductive physiology .

How does recombinant bovine HSD17B12 expression correlate with epigenetic modifications during inflammatory challenges?

The relationship between bovine HSD17B12 expression and epigenetic modifications during inflammatory challenges involves complex interactions with hormonal factors. Research on bovine mammary epithelial cells (bMECs) demonstrates that hormones like prolactin and estradiol function as epigenetic modulators during bacterial infections such as Staphylococcus aureus .

Specifically, hormonal treatment affects histone H3 acetylation and methylation patterns, which in turn influence the expression of inflammatory response genes. While the search results don't provide direct measurement of HSD17B12 expression changes during these epigenetic modifications, they establish a framework where:

  • Hormones that interact with HSD17B12 (including estradiol) modify histone acetylation patterns

  • These epigenetic changes alter gene expression profiles during inflammatory challenges

  • The timing of hormonal exposure (12h versus 24h) yields different epigenetic outcomes

  • Bacterial infection further modulates these epigenetic responses

Researchers investigating this relationship should employ chromatin immunoprecipitation (ChIP) assays to directly assess histone modifications at the HSD17B12 promoter region, RNA-seq to capture expression changes, and consider time-course experiments to map the dynamic relationships between hormone exposure, epigenetic changes, and HSD17B12 expression during inflammatory responses.

What methodological approaches best characterize the dual functionality of HSD17B12 in both fatty acid elongation and estradiol synthesis?

Characterizing HSD17B12's dual functionality requires integrated methodological approaches targeting both enzymatic activities. To comprehensively study this enzyme, researchers should implement:

  • Enzyme Activity Assays:

    • Measure conversion of estrone to estradiol using radioimmunoassay or LC-MS/MS

    • Assess fatty acid elongation by tracking incorporation of labeled acetyl-CoA into longer chain fatty acids

    • Conduct kinetic analyses to determine substrate preferences and enzyme efficiency

  • Structural Biology Approaches:

    • X-ray crystallography or cryo-EM to resolve the enzyme's structure with different substrates

    • Site-directed mutagenesis to identify residues crucial for each function

    • Molecular dynamics simulations to understand conformational changes during catalysis

  • Cellular Assays:

    • Measure changes in ceramide profiles and fatty acid composition using lipidomics

    • Analyze estradiol production in cells expressing wild-type versus mutant HSD17B12

    • Use fluorescently-tagged HSD17B12 to confirm endoplasmic reticulum localization

  • Genomic and Transcriptomic Approaches:

    • RNA-seq to identify genes co-regulated with HSD17B12 under various conditions

    • ChIP-seq to map transcription factor binding at the HSD17B12 promoter

    • Real-time PCR to quantify expression changes in response to hormonal treatments

  • Conditional Knockout Studies:

    • Create tissue-specific knockouts to distinguish phenotypes related to each function

    • Time-resolved analysis of metabolic changes following inducible gene inactivation

    • Rescue experiments with mutants capable of only one function

This multi-faceted approach allows researchers to dissect the relative contributions of HSD17B12's dual functions in different physiological contexts.

What is the optimal expression system for producing functional recombinant bovine HSD17B12?

For producing functional recombinant bovine HSD17B12, researchers should consider several expression systems with their respective advantages:

  • Mammalian Expression Systems:

    • HEK293 or CHO cells provide proper post-translational modifications

    • Appropriate for maintaining native enzyme activity and conformation

    • Essential when studying enzyme interactions with mammalian cellular components

    • Recommended for studies focusing on protein-protein interactions or regulatory mechanisms

  • Insect Cell Systems:

    • Baculovirus-infected Sf9 or High Five cells offer high yields with eukaryotic processing

    • Balance between bacterial system yields and mammalian authenticity

    • Particularly suitable for structural biology studies requiring milligram quantities

  • Yeast Expression Systems:

    • Pichia pastoris combines high expression with appropriate eukaryotic processing

    • Economical scale-up for larger preparations

    • Useful for enzymological studies requiring substantial protein amounts

  • Bacterial Systems:

    • E. coli offers high yields but may compromise enzyme folding and activity

    • Consider fusion tags (MBP, SUMO) to enhance solubility

    • Suitable for limited applications where post-translational modifications are not critical

For most research applications, mammalian expression systems are optimal as they ensure proper folding and post-translational modifications essential for the dual functionality of HSD17B12. When designing expression constructs, researchers should include a purification tag (His6, FLAG, or Strep-tag II) that can be cleaved post-purification to minimize interference with enzyme activity. Additionally, codon optimization for the expression host and inclusion of chaperones may further enhance functional protein yield.

How should researchers design knockout or knockdown experiments to study HSD17B12 function in bovine models?

Designing effective knockout or knockdown experiments for bovine HSD17B12 requires careful consideration of the enzyme's essential nature and specific research questions. Based on mouse studies showing embryonic lethality of constitutive knockouts and rapid health deterioration in adult conditional knockouts , researchers should implement:

  • Inducible Conditional Knockout Approaches:

    • Use Cre-loxP systems with tamoxifen-inducible promoters as demonstrated in mouse models

    • Target specific tissues relevant to either estradiol production (ovaries) or fatty acid metabolism (liver, adipose)

    • Include careful timing protocols, as HSD17B12 deficiency rapidly leads to health deterioration

  • RNA Interference and CRISPR-Based Knockdown:

    • Design multiple siRNAs or shRNAs targeting different exons to ensure specificity

    • Validate knockdown efficiency via qPCR and western blot

    • Consider inducible shRNA systems to control the degree and timing of knockdown

    • For partial knockdowns, titrate concentration of interfering RNA to achieve desired expression levels

  • Ex Vivo and In Vitro Approaches:

    • Primary bovine cell cultures (mammary epithelial cells, hepatocytes, adipocytes) provide controlled environments

    • Organoid cultures bridge the gap between cell culture and whole animal models

    • Analyze both immediate (24-48h) and long-term effects to distinguish direct from compensatory responses

  • Monitoring Parameters:

    • Track animal health with specialized scoring systems for early identification of distress

    • Implement comprehensive lipidomics to map ceramide and fatty acid changes

    • Monitor inflammatory markers (IL-6, IL-17, G-CSF) shown to increase with HSD17B12 deficiency

    • Measure food and water intake as these decrease dramatically in knockout models

  • Rescue Experiments:

    • Include experimental groups receiving exogenous long-chain fatty acids to determine if phenotypes are primarily due to fatty acid elongation defects

    • Consider estradiol supplementation to distinguish between the enzyme's dual functions

Given the severe phenotypes observed in mouse models, researchers must prioritize animal welfare with clearly defined humane endpoints, frequent monitoring, and appropriate ethical approvals.

What analytical methods provide the most comprehensive assessment of HSD17B12's impact on lipid profiles?

Comprehensive assessment of HSD17B12's impact on lipid profiles requires sophisticated analytical approaches that capture both global changes and specific lipid species alterations. Based on research findings, the following methods provide optimal insights:

  • Untargeted Lipidomics:

    • Liquid chromatography coupled with high-resolution mass spectrometry (LC-HRMS) to detect global lipid changes

    • Appropriate for discovering unexpected lipid alterations without prior hypotheses

    • Essential for identifying novel lipid species affected by HSD17B12 activity

  • Targeted Analysis of Specific Lipid Classes:

    • Focused LC-MS/MS methods for:

      • Ceramides and dihydroceramides (shown to accumulate with HSD17B12 deficiency)

      • Hexosylceramides and lactosylceramides

      • Very long chain fatty acids (VLCFAs)

      • Acylcarnitines as indicators of fatty acid oxidation status

  • Fatty Acid Analysis:

    • Gas chromatography (GC-MS) to quantify fatty acid chain length distribution

    • Stable isotope labeling to track fatty acid elongation rates

    • Special focus on fatty acids with chains shorter than 18 carbons, which accumulate with HSD17B12 deficiency

  • Spatial Lipidomics:

    • Mass spectrometry imaging (MSI) to visualize tissue distribution of affected lipids

    • Particularly valuable for examining liver, which shows steatosis in HSD17B12 knockout models

  • Functional Lipid Trafficking:

    • Fluorescently labeled lipid precursors to track synthesis and transport

    • Live-cell imaging to monitor lipid droplet formation and dynamics

  • Multi-Omics Integration:

    • Combine lipidomics with transcriptomics to correlate lipid changes with gene expression

    • Integrate with proteomics to identify changes in lipid-processing enzymes

For data analysis, multivariate statistical approaches (principal component analysis, partial least squares discriminant analysis) help identify patterns in complex lipid changes. Pathway analysis should focus on ceramide biosynthesis, fatty acid elongation, and inflammatory signaling pathways implicated in HSD17B12 deficiency .

How can researchers effectively measure both enzymatic activities of HSD17B12 in the same experimental setup?

Measuring both enzymatic activities of HSD17B12—estradiol synthesis and fatty acid elongation—in the same experimental setup requires careful assay design that accommodates different reaction conditions while minimizing interference between pathways. Here's a comprehensive protocol approach:

  • Bifunctional Assay System:

    • Use microsomal preparations or purified recombinant HSD17B12 in a buffered system compatible with both activities

    • Phosphate buffer (pH 7.4) with appropriate cofactors (NADPH for both reactions)

    • Include detergents at concentrations that maintain enzyme structure while solubilizing lipid substrates

  • Sequential Activity Measurements:

    • First phase: Add [³H]-estrone and measure conversion to [³H]-estradiol over 30 minutes

    • Second phase: Add malonyl-CoA and [¹⁴C]-palmitoyl-CoA to the same reaction mixture

    • Final analysis: Separate and quantify both [³H]-estradiol and [¹⁴C]-stearoyl-CoA products

  • Parallel Reactions with Specific Inhibitors:

    • Split enzyme preparation into multiple reactions

    • Reference reaction: No inhibitors, measure both activities

    • Selective inhibition: Add specific inhibitors for each pathway to distinguish activities

    • Suitable inhibitors include those targeting HSD enzymes (for estradiol synthesis) or fatty acid elongases (for elongation activity)

  • Real-time Monitoring:

    • Develop fluorescent or bioluminescent reporters for each product

    • Use FRET-based sensors for conformational changes associated with substrate binding

    • Monitor reaction progress with stopped-flow spectroscopy for kinetic analysis

  • Analysis and Quantification:

    • For estradiol synthesis: ELISA or radioimmunoassay for product quantification

    • For fatty acid elongation: GC-MS or LC-MS/MS to measure chain-lengthened products

    • Calculate enzyme kinetic parameters (Km, Vmax) for each substrate

    • Analyze potential substrate competition between pathways

  • Validation Controls:

    • Include recombinant enzymes with known single functionality as controls

    • Use site-directed mutants affecting each activity separately

    • Perform inhibitor dose-response curves to confirm specificity

This integrated approach allows researchers to determine whether the two enzymatic activities influence each other, operate independently, or share rate-limiting steps, providing deeper insights into HSD17B12's functional duality.

How should researchers interpret conflicting data regarding HSD17B12 expression in response to estradiol treatment?

Interpreting conflicting data regarding HSD17B12 expression in response to estradiol treatment requires a nuanced approach that considers multiple experimental factors. The search results indicate that 17beta-estradiol can both increase and decrease HSD17B12 expression under different experimental conditions , creating an apparent contradiction that needs systematic analysis.

Researchers should address these conflicts through:

By systematically addressing these factors, researchers can resolve apparent contradictions and develop a more nuanced understanding of how estradiol regulates HSD17B12 expression across different physiological contexts.

What statistical approaches are most appropriate for analyzing the dual impacts of HSD17B12 on lipid metabolism and estradiol production?

Analyzing the dual impacts of HSD17B12 on lipid metabolism and estradiol production requires sophisticated statistical approaches that can handle multifunctional effects and complex data structures. Researchers should consider:

  • Multivariate Methods:

    • Principal Component Analysis (PCA) to reduce dimensionality of complex lipid profiles

    • Partial Least Squares Discriminant Analysis (PLS-DA) to identify lipid species most affected by HSD17B12 manipulation

    • Canonical correlation analysis to examine relationships between lipid changes and steroid hormone levels

    • MANOVA to simultaneously assess multiple dependent variables across experimental groups

  • Systems Biology Approaches:

    • Pathway enrichment analysis incorporating both lipid metabolism and steroid biosynthesis pathways

    • Network analysis to identify hub metabolites connecting both functional domains

    • Flux balance analysis to quantify metabolic shifts between pathways

  • Longitudinal Data Analysis:

    • Mixed effects models to account for repeated measures and individual variation

    • Time series analysis to capture dynamic responses following HSD17B12 manipulation

    • Growth curve modeling for developmental studies where HSD17B12 effects may change over time

  • Causal Inference Methods:

    • Structural equation modeling to test hypothesized causal relationships

    • Mediation analysis to determine whether effects on one pathway mediate effects on the other

    • Directed acyclic graphs to visualize and test causal relationships

  • Specialized Lipidomics Statistics:

    • Compositional data analysis for lipid percentage data

    • Zero-inflated models for lipid species with many non-detects

    • Random forests or support vector machines for classification based on lipid profiles

  • Integrated Multi-Omics Analysis:

    • Joint modeling of lipidomics, steroidomics, and transcriptomics data

    • Multi-block methods to integrate data from different analytical platforms

    • O2PLS for multi-view data integration

When reporting results, researchers should clearly distinguish between statistical significance and biological relevance, provide effect sizes alongside p-values, and implement appropriate multiple testing corrections (e.g., Benjamini-Hochberg FDR) to control false discovery rates across numerous lipid species and hormone measurements.

How can researchers distinguish between direct effects of HSD17B12 and secondary compensatory responses in knockout studies?

Distinguishing between direct effects of HSD17B12 deficiency and secondary compensatory responses in knockout studies requires strategic experimental design and careful data interpretation. Based on the knockout mouse studies showing rapid, severe phenotypes , researchers should implement:

  • Temporal Analysis Strategies:

    • Conduct time-course experiments with sampling at multiple early timepoints (2h, 6h, 12h, 24h post-induction)

    • Compare rapid changes (likely direct effects) versus delayed alterations (potentially compensatory)

    • Use inducible systems (like tamoxifen-inducible Cre ) for precise temporal control

    • Implement RNA-seq at multiple timepoints to identify sequential waves of gene expression changes

  • Pharmacological Validation:

    • Compare knockout phenotypes with acute chemical inhibition of HSD17B12

    • Use selective inhibitors that target either the estradiol synthesis or fatty acid elongation function

    • Administer specific pathway inhibitors to knockout models to detect additive, synergistic, or redundant effects

  • Molecular Signature Analysis:

    • Create molecular signatures of direct HSD17B12 targets through ChIP-seq or CLIP-seq

    • Develop computational algorithms to distinguish primary transcriptional responses from secondary cascades

    • Use proteomics approaches to identify early post-translational modifications preceding transcriptional changes

  • Rescue Experiments:

    • Perform pathway-specific rescue experiments (e.g., provide exogenous long-chain fatty acids)

    • Design mutant HSD17B12 variants with selective activity (estradiol synthesis or fatty acid elongation)

    • Create graded knockdown series to identify threshold effects and dose-dependent responses

  • Multi-tissue Comparison:

    • Compare responses across tissues with different HSD17B12 expression levels

    • Focus on tissue-specific primary functions (e.g., estradiol synthesis in ovaries versus fatty acid elongation in liver)

    • Identify tissue-specific versus systemic responses to distinguish local from secondary effects

  • Systems Biology Approaches:

    • Network analysis to differentiate hub responses (likely primary) from peripheral effects (potentially compensatory)

    • Metabolic flux analysis to track altered pathway activities in real-time

    • Mathematical modeling to predict primary effect propagation through biochemical networks

When analyzing inflammatory responses, researchers should note that the rapid increase in proinflammatory cytokines (IL-6, IL-17, G-CSF) following HSD17B12 knockout suggests these may be early consequences rather than secondary adaptations, despite being seemingly separate from the enzyme's direct biochemical functions.

What emerging technologies might advance our understanding of HSD17B12's role in bovine physiology?

Several cutting-edge technologies have the potential to significantly advance our understanding of HSD17B12's multifaceted roles in bovine physiology:

  • CRISPR-Based Technologies:

    • Base editing for introducing precise point mutations to study structure-function relationships

    • CRISPRi/CRISPRa for reversible modulation of HSD17B12 expression without permanent genetic changes

    • CRISPR screens to identify genetic interactors of HSD17B12 in different bovine cell types

    • Prime editing for introducing specific mutations that separate the enzyme's dual functions

  • Advanced Imaging Techniques:

    • STORM/PALM super-resolution microscopy to visualize HSD17B12 localization at nanoscale resolution

    • Live-cell imaging with split fluorescent proteins to track protein-protein interactions in real-time

    • Correlative light and electron microscopy to examine HSD17B12 in the context of endoplasmic reticulum ultrastructure

    • Intravital microscopy to observe HSD17B12 dynamics in living bovine tissues

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell populations particularly dependent on HSD17B12

    • Single-cell proteomics to detect cell-specific protein interaction networks

    • Spatial transcriptomics to map HSD17B12 expression patterns across tissue microenvironments

    • Single-cell metabolomics to correlate cellular metabolism with HSD17B12 expression levels

  • Advanced Mass Spectrometry:

    • Cross-linking mass spectrometry to identify protein interaction partners

    • Hydrogen-deuterium exchange mass spectrometry to study conformational dynamics

    • MALDI-imaging mass spectrometry for spatial analysis of lipids affected by HSD17B12

    • Thermal proteome profiling to identify HSD17B12 substrates and interactors

  • Organoid and Microphysiological Systems:

    • Bovine tissue-specific organoids to study HSD17B12 in complex 3D environments

    • Organ-on-chip systems combining multiple bovine tissues to examine systemic effects

    • Bioprinted tissue models with controlled HSD17B12 expression gradients

    • Patient-derived xenografts using bovine cells for in vivo functional studies

  • Computational Approaches:

    • AlphaFold and other AI tools to predict HSD17B12 structure and substrate interactions

    • Molecular dynamics simulations to understand enzyme mechanism at atomic resolution

    • Network medicine approaches to position HSD17B12 within disease pathways

    • Digital twin models of bovine metabolic systems to predict HSD17B12 perturbation effects

Integration of these technologies will provide unprecedented insights into how HSD17B12 coordinates lipid metabolism and hormone production in bovine physiology, potentially revealing new therapeutic targets for production animals and models for human metabolic disorders.

How might comparative studies across species enhance our understanding of HSD17B12 function in bovine systems?

Comparative studies across species offer powerful approaches to enhance our understanding of HSD17B12 function in bovine systems by highlighting conserved essential functions versus species-specific adaptations. Researchers should consider:

  • Evolutionary Conservation Analysis:

    • Compare HSD17B12 sequences across mammals with diverse metabolic adaptations (hibernators, marine mammals, ruminants)

    • Identify conserved catalytic domains versus variable regulatory regions

    • Perform phylogenetic analysis to trace evolutionary changes coinciding with metabolic specializations

    • Reconstruct ancestral sequences to understand evolutionary constraints on dual functionality

  • Cross-Species Functional Complementation:

    • Test whether bovine HSD17B12 can rescue phenotypes in mouse or human cell knockouts

    • Identify species-specific interaction partners through comparative proteomics

    • Create chimeric enzymes with domains from different species to map functional regions

    • Express bovine HSD17B12 in yeast or bacterial systems lacking endogenous equivalents

  • Comparative Physiological Studies:

    • Compare HSD17B12 expression and regulation during lactation across dairy animals

    • Analyze species differences in response to HSD17B12 inhibition or deficiency

    • Examine correlations between HSD17B12 polymorphisms and production traits across breeds

    • Study seasonal variations in HSD17B12 expression in species with reproductive seasonality

  • Multi-Species -Omics Approaches:

    • Conduct comparative transcriptomics of tissues from bovine, human, mouse, and other species

    • Perform cross-species metabolomics to identify conserved versus divergent metabolic impacts

    • Use comparative epigenomics to identify conserved regulatory elements controlling HSD17B12 expression

    • Integrate comparative genomics with phenotype data to link genetic variations to functional differences

  • Translational Research Applications:

    • Apply insights from mouse knockout studies to predict potential effects in bovine systems

    • Utilize human disease associations to identify potential impacts on bovine health and production

    • Leverage differential responses to environmental toxins across species to understand regulatory mechanisms

    • Develop cross-species biomarkers of HSD17B12 dysfunction

  • Specialized Comparative Approaches:

    • Compare tissue-specific expression patterns across ruminant versus non-ruminant mammals

    • Analyze differences in HSD17B12 function between seasonal and non-seasonal breeders

    • Examine correlations between HSD17B12 polymorphisms and milk fat composition across dairy species

    • Study adaptations in high-altitude bovine breeds with different metabolic requirements

These comparative approaches can reveal which aspects of HSD17B12 function are fundamental across mammals and which have evolved specifically in bovine systems to support their unique metabolic and reproductive requirements, ultimately providing more targeted approaches for research and applications in cattle.

What are the most significant unanswered questions about bovine HSD17B12 that researchers should prioritize?

Several critical questions about bovine HSD17B12 remain unanswered and should be prioritized by researchers to advance our understanding of this multifunctional enzyme. Based on current knowledge gaps evident in the search results, key research priorities include:

  • Regulatory Mechanisms:

    • How is bovine HSD17B12 expression regulated during different physiological states (lactation, pregnancy, growth)?

    • What transcription factors and epigenetic modifications control tissue-specific expression patterns?

    • How do metabolic signals integrate with hormonal regulation to modulate HSD17B12 activity?

  • Functional Balance:

    • What determines the balance between HSD17B12's dual functions in estradiol synthesis versus fatty acid elongation?

    • Do these activities compete for enzyme availability, or are they independently regulated?

    • How does this functional balance shift across different bovine tissues and physiological states?

  • Pathophysiological Implications:

    • What role does HSD17B12 play in bovine metabolic disorders and inflammatory conditions?

    • Could HSD17B12 dysfunction contribute to reproductive inefficiencies in dairy cattle?

    • How does HSD17B12 activity change during mastitis and other inflammatory conditions ?

  • Molecular Interactions:

    • What protein complexes does bovine HSD17B12 form in different cellular contexts?

    • How do these interactions modulate enzyme activity and substrate specificity?

    • What post-translational modifications regulate HSD17B12 function in bovine tissues?

  • Production Relevance:

    • How do HSD17B12 polymorphisms correlate with economically important traits in cattle?

    • Could selective breeding for optimal HSD17B12 variants improve metabolic health and production?

    • What nutritional factors influence HSD17B12 expression and activity in production settings?

  • Comparative Physiology:

    • How does bovine HSD17B12 function differ from human and mouse orthologs studied more extensively ?

    • Are there ruminant-specific adaptations in HSD17B12 structure or regulation?

    • Do the severe phenotypes observed in mouse knockouts translate to bovine systems?

Addressing these questions will require interdisciplinary approaches combining molecular biology, biochemistry, genetics, and systems biology. Particular attention should be given to developing bovine-specific models rather than relying exclusively on insights from rodent systems, given the potential for species-specific adaptations in this enzyme's function and regulation.

How can advanced knowledge of HSD17B12 potentially impact agricultural and biomedical research?

Advanced knowledge of HSD17B12 has significant potential to impact both agricultural applications in bovine production systems and biomedical research leveraging comparative biology. Potential impacts include:

Agricultural Applications:

  • Reproductive Efficiency:

    • Development of biomarkers for optimal estradiol production and reproductive readiness

    • Targeted interventions to modulate HSD17B12 activity during key reproductive phases

    • Genetic selection for HSD17B12 variants associated with improved fertility

    • Hormone-based protocols that work synergistically with natural HSD17B12 activity

  • Metabolic Health Management:

    • Early detection of animals predisposed to metabolic disorders based on HSD17B12 profiles

    • Nutritional strategies to support optimal HSD17B12 function during transitions

    • Precision monitoring of lipid metabolism via HSD17B12-associated biomarkers

    • Prevention of fatty liver conditions by supporting proper lipid homeostasis

  • Milk Production and Composition:

    • Selective breeding for optimal HSD17B12 variants affecting milk fat synthesis

    • Feed formulations that support HSD17B12-dependent fatty acid elongation

    • Monitoring HSD17B12 expression as a biomarker for mammary gland function

    • Development of interventions to maintain mammary health during inflammation

Biomedical Research Applications:

  • Comparative Disease Modeling:

    • Utilizing bovine HSD17B12 studies to understand human metabolic disorders

    • Developing therapeutic strategies based on species-conserved mechanisms

    • Identifying natural variations in bovine HSD17B12 that confer metabolic resilience

    • Understanding inflammation-metabolism interactions through comparative biology

  • One Health Approaches:

    • Studying environmental toxins that affect HSD17B12 across species

    • Investigating HSD17B12's role in inflammatory responses shared between humans and cattle

    • Developing cross-species applicable interventions for metabolic disorders

    • Using bovine models to study lipid-mediated inflammatory conditions

  • Translational Applications:

    • Drug development targeting HSD17B12 for metabolic and reproductive disorders

    • Biomarker development for early detection of inflammatory conditions

    • Nutraceutical approaches to support optimal lipid homeostasis

    • Therapeutic strategies targeting ceramide metabolism revealed through HSD17B12 studies

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.