Recombinant Bovine FAD-dependent oxidoreductase domain-containing protein 1 (FOXRED1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery timelines.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FOXRED1; FAD-dependent oxidoreductase domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-486
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FOXRED1
Target Protein Sequence
MLRRALRLRLGPCLSGRGLGTYRRGSTLDWDGKVSEIKKKIQSIFPGGAWNPLYDTSHLP PERSDVVIVGGGVLGLSVAYWLKRLEKQQGAIRVLVVERDHTYARASTVLSVGGIRQQFS LPQNVQLSLFSAEFLRNINEYLAVVDDPPLDLQFNPSGYLLLASEEGAAIMERNVKMQRQ EGAKVCLMSPEQLQKKFPWINTEGVALASYGLENEGWFDPWCLLQGLRRKLQSMGVLFCQ GEVTRFISSSSHMETASGEQLTLKRIHEVHVKMDHSQEFQPVECAIVVNAAGAWSGQIAE LAGVGNGPPGTMQGTKLPVEPRKRYVYLWHCPQGPGLEAPLVADPSGAYFRREGLGNNYV GSCSPTEEEEPDPGNLEVDYDFFQEKVWPRLAQRVPAFETLKVRSAWAGYYDYNTFDQNG VVGPHPLVVNMYFATGFSGHGLQQAPAVGRAVAEMVLEGHFQTINLSPFLFSRFYFGEKA QEHCIL
Uniprot No.

Target Background

Function
Essential for the assembly of the mitochondrial respiratory chain NADH dehydrogenase (Complex I). Plays a role in the mid-to-late stages of Complex I assembly.
Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the structural and functional characterization of bovine FOXRED1?

FOXRED1 is a 53 kDa protein containing an FAD-dependent oxidoreductase domain that localizes to the mitochondria. The protein functions as a molecular chaperone required for the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) . Specifically, FOXRED1 is involved in the mid-late stages of complex I assembly, as determined through subcellular fractionation and immunoprecipitation studies . Structurally, protein modeling using the Bacillus monomeric sarcosine oxidase structure as a template has revealed that FOXRED1 contains key conserved regions around the FAD-binding site . This model has been valuable for analyzing how mutations, such as those at position R352, might impact protein function by potentially interfering with FAD binding.

What are the recommended methods for recombinant expression of bovine FOXRED1?

For optimal recombinant expression of bovine FOXRED1:

  • Vector Design Considerations: Synthetic codon-optimized FOXRED1 gene constructs should be designed to include a Kozak sequence (to increase translational initiation) and appropriate stop codons . For mammalian expression systems, inclusion of a strong promoter such as CMV is recommended.

  • Expression Systems:

    • Mammalian Systems: HEK293T cells are preferable for maintaining proper post-translational modifications and folding.

    • Bacterial Systems: E. coli expression is possible with an N-terminal His-tag for purification, but requires optimization to address potential misfolding.

  • Purification Strategy:

    • Initial capture via immobilized metal affinity chromatography (IMAC)

    • Secondary purification through ion exchange chromatography

    • Final polishing via size exclusion chromatography to obtain >95% purity

  • Verification Methods: Western blot analysis using anti-FOXRED1 antibodies that recognize the 53 kDa band, with optimal antibody dilutions of 1:500-1:2000 for western blotting applications .

How should researchers evaluate FOXRED1 activity in biochemical assays?

Multiple assay systems can be employed to assess FOXRED1 activity:

Standard Enzymatic Assays:

  • DCPIP Reduction Assay: Measures the rate of 2,6-dichlorophenolindophenol (DCPIP) reduction, which correlates with FAD-dependent oxidoreductase activity .

  • Peroxidase-Coupled Assay: Utilizes peroxidase and o-dianisidine to measure hydrogen peroxide production, allowing assessment of oxygen reduction capability .

Complex I Assembly Assessment:

  • Blue Native PAGE: Critical for visualizing the formation of complex I subcomplexes and holoenzyme. Patient studies have shown that FOXRED1 mutations lead to accumulation of subcomplexes centered around ~340 kDa and ~550 kDa, with decreased levels of fully assembled complex I .

  • Complex I Activity Dipstick Assays: Provide semi-quantitative measurement of complex I activity, with FOXRED1-silenced cells showing approximately 40% residual complex I activity compared to controls .

Data Analysis Parameters:

  • Calculate apparent catalytic efficiency (kcat/KM) values, which typically range from 2×10³-5×10⁴ M⁻¹s⁻¹ for FAD-dependent oxidoreductases with small substrates .

  • Determine KM values, which typically range from 0.2-5 mM for related FAD-dependent enzymes .

What subcellular localization patterns should be expected for bovine FOXRED1?

FOXRED1 demonstrates specific subcellular localization patterns that can be visualized through immunofluorescence microscopy:

  • Mitochondrial Targeting: FOXRED1 contains a predicted N-terminal mitochondrial targeting sequence of 24 amino acids . Western blot data confirm mitochondrial localization with a band of ~53 kDa in whole mitochondrial fractions .

  • Sub-mitochondrial Distribution: Interestingly, FOXRED1 appears to be distributed within specific mitochondrial compartments. Western blot studies have detected slightly larger bands (>53 kDa) in both the intermembrane space (IMS) and the matrix . This suggests a potential dynamic localization pattern where:

    • A FOXRED1 precursor containing the mitochondrial import sequence is imported via the TOM/TIM machinery

    • The import sequence is subsequently cleaved within the matrix

    • The mature protein associates with the mitochondrial inner membrane near respiratory chain supercomplexes

  • Validation Methods: For confirming correct subcellular localization, researchers should employ:

    • Subcellular fractionation followed by western blotting

    • Immunofluorescence microscopy with mitochondrial markers (e.g., MitoTracker)

    • Protease protection assays to determine membrane topology

How does FOXRED1 interact with other complex I assembly factors and what methodologies best capture these interactions?

FOXRED1 functions within a network of complex I assembly factors, with interactions that can be elucidated through various experimental approaches:

Established Interactions:

  • FOXRED1 has been shown to co-immunoprecipitate with AIFM1 and ACAD9, suggesting a functional interaction complex .

  • These proteins associate with a 370-kDa complex I subassembly that, together with a 315-kDa subassembly, forms the 550-kDa subcomplex .

Recommended Methodologies:

  • Co-immunoprecipitation Protocol:

    • Solubilize mitochondrial extracts using 0.5% dodecyl maltoside (DDM)

    • Perform immunoprecipitation with magnetic Dynabeads conjugated to FOXRED1 antibodies

    • Incubate overnight at 4°C for optimal binding

    • Elute bound proteins with 0.1 M glycine (pH 2.5) containing 0.5% DDM

    • Analyze by mass spectrometry

  • Size Exclusion Chromatography:

    • Fractionate mitochondrial protein extracts on a Superdex 200 column

    • Analyze fractions by immunoblotting to determine co-elution profiles

    • Expected FOXRED1-containing complexes range from 340-620 kDa

  • BN-PAGE Combined with Second-dimension SDS-PAGE:

    • First dimension: separate native complexes

    • Second dimension: resolve individual complex components

    • Identify co-migrating proteins by immunoblotting or mass spectrometry

Data Interpretation Framework:
A comprehensive interaction map should include direct binding partners, assembly intermediates that contain FOXRED1, and temporal assembly sequence information.

How should researchers address experimental variability in FOXRED1 functional studies?

Functional studies of FOXRED1 present several challenges that require careful experimental design:

Sources of Variability:

  • FAD Availability: Since FOXRED1 is FAD-dependent, variations in cellular flavin content can affect experimental outcomes .

  • Cell-type Specificity: FOXRED1's role differs between cell types, particularly between myoblasts and fibroblasts .

  • Mitochondrial Heterogeneity: Differences in mitochondrial content and function between cell lines and preparations.

Recommended Controls and Normalization Strategies:

  • FAD-loading Protocol:

    • Pre-incubate cells or protein preparations with standard concentrations of FAD (10-50 μM)

    • Monitor cellular uptake of flavins if possible

    • Consider using a defined medium with controlled riboflavin concentrations

  • Complementation Controls:

    • Include wild-type FOXRED1 expression as positive control

    • Use empty vector transduction as negative control

    • When studying mutations, include known pathogenic and benign variants

  • Normalization Standards:

    • For complex I activity: normalize to citrate synthase activity or complex IV activity

    • For protein expression: use multiple housekeeping genes/proteins

    • For cellular studies: normalize to mitochondrial mass using MitoTracker or similar markers

  • Statistical Approaches:

    • Perform at least three independent experiments with technical triplicates

    • Apply appropriate statistical tests (ANOVA followed by post-hoc tests)

    • Report effect sizes along with p-values

What are the implications of FOXRED1 research for understanding human mitochondrial disorders?

Recombinant bovine FOXRED1 research has significant implications for human mitochondrial diseases:

Clinical Relevance of FOXRED1 Mutations:

  • Disease Spectrum: Mutations in human FOXRED1 cause mitochondrial complex I deficiency (nuclear type 19) and are associated with encephalomyopathy .

  • Genotype-Phenotype Correlation: No clear genotype-phenotype correlation has been established for FOXRED1-related disorders, suggesting complex pathomechanisms .

  • Key Clinical Findings in FOXRED1 Patients:

    • Leigh syndrome

    • Infantile-onset encephalomyopathy

    • Severe psychomotor retardation

    • Lactic acidosis

    • Characteristic polycystic encephalomalacia on brain MRI

Translational Research Applications:

  • Disease Modeling: Bovine FOXRED1 can be used to model human disease mutations through:

    • Site-directed mutagenesis to recreate patient mutations

    • Functional complementation studies in patient fibroblasts

    • Structure-function analyses using recombinant proteins

  • Therapeutic Development Strategy:

    • Screening for small molecules that stabilize mutant FOXRED1

    • Exploring FAD supplementation as a potential therapeutic approach

    • Developing gene therapy vectors for FOXRED1 replacement

  • Biomarker Development:

    • Correlation of FOXRED1 dysfunction with metabolic signatures

    • Identification of complex I subassemblies as diagnostic markers

    • Development of functional assays for patient diagnosis

What is the role of FOXRED1 in the flavin metabolism network and how should this be considered in experimental design?

FOXRED1's dependency on FAD connects it to the broader cellular flavin metabolism network:

Flavin Metabolism Considerations:

  • FAD Synthesis and Transport: Cellular FAD is synthesized from riboflavin (vitamin B2) through the sequential action of riboflavin kinase (RFK) and FAD synthase (FADS) . Mitochondria import FAD through specific transporters.

  • Covalent vs. Non-covalent FAD Binding: Unlike some other flavoproteins where FAD is covalently bound (e.g., SDHA of complex II), FOXRED1 appears to bind FAD non-covalently, making its activity potentially more sensitive to cellular FAD availability .

  • Competition for FAD: Multiple flavoproteins compete for the limited pool of cellular FAD, including other OXPHOS components.

Experimental Design Recommendations:

  • Media Considerations:

    • Use defined media with known riboflavin concentrations

    • Consider riboflavin supplementation experiments (1-10 μM range)

    • Monitor effects of riboflavin depletion on FOXRED1 function

  • FAD Binding Assessment:

    • Spectroscopic analysis of recombinant FOXRED1 (absorbance at 450 nm)

    • Fluorescence quenching studies to determine FAD binding affinity

    • Thermal shift assays to assess stabilization by FAD

  • Integration with Broader Metabolism:

    • Monitor effects of FOXRED1 manipulation on other flavoenzymes

    • Consider co-supplementation with other B vitamins involved in mitochondrial function

    • Assess redox status alongside FOXRED1 studies

How can researchers effectively validate novel FOXRED1 variants of uncertain significance?

With expanding genetic testing, novel FOXRED1 variants are being identified that require functional validation:

Comprehensive Validation Pipeline:

  • In Silico Analysis:

    • Evolutionary conservation assessment using multiple sequence alignment

    • Structural modeling to predict impact on FAD binding site or protein stability

    • Use of prediction algorithms (SIFT, PolyPhen-2, GERP, PhyloP)

  • Expression Studies:

    • Quantify mRNA levels using qRT-PCR

    • Assess protein stability in patient-derived cells or overexpression systems

    • Determine subcellular localization of variant proteins

  • Functional Assays:

    • Complex I Assembly: Blue-native PAGE to visualize accumulated subcomplexes

    • Protein Interactions: Co-IP studies to assess interactions with AIFM1 and ACAD9

    • Enzymatic Activity: DCPIP reduction assays to measure oxidoreductase function

  • Rescue Experiments:

    • Lentiviral/retroviral transduction of wild-type FOXRED1 in patient cells

    • Quantitative assessment of rescue efficiency at the biochemical and cellular levels

Case Study Example:
A study demonstrated the pathogenicity of the p.R352W variant through:

  • Segregation analysis in the family

  • Reduced steady-state levels of FOXRED1 in patient fibroblasts

  • Decreased complex I holoenzyme by BN-PAGE

  • Complete restoration of complex I activity after lentiviral transduction with wild-type FOXRED1

This comprehensive approach provides a template for validating novel variants.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.