Recombinant Bovine Fat storage-inducing transmembrane protein 1 (FITM1)

Shipped with Ice Packs
In Stock

Description

Role in Lipid Metabolism

FITM1 mediates triglyceride partitioning from the ER into cytosolic lipid droplets without affecting biosynthesis . Its functions include:

  • Lipid Droplet Formation: Critical for LD biogenesis in adipocytes and skeletal muscle .

  • Lipid Homeostasis: Regulates neutral lipid storage and prevents ectopic lipid accumulation .

  • Interaction with PPARα: A transcriptional target of peroxisome proliferator-activated receptor α (PPARα), linking it to fibrate-driven lipid metabolism .

Lipid Droplet Dynamics

  • Bovine Adipocytes: FITM1 overexpression increases LD size and number, mimicking its role in human adipose tissue .

  • Triglyceride Binding: Direct interaction with TG/DAG stabilizes lipid droplets and prevents lipotoxicity .

Pathway Interactions

FITM1 intersects with:

  • PPARα Signaling: Regulated by fibrate-induced transcriptional activation .

  • NOTCH Signaling: Hypermethylation of FITM1 in non-viral hepatocellular carcinoma (HCC) correlates with pathway activation .

Comparative Analysis with FITM2

FeatureFITM1FITM2
Tissue ExpressionSkeletal muscleUbiquitous (adipose tissue dominant)
Lipid BindingStrong TG/DAG affinitySimilar, but weaker than FITM1
Mutant ImpactEnhanced LD formation (e.g., FLL→AAA)Conformational changes alter activity

Potential Applications in Bovine Research

  • Lipid Storage Optimization: Engineering FITM1 to enhance triglyceride storage for improved meat quality.

  • Metabolic Disease Models: Studying FITM1 dysregulation in bovine metabolic disorders (e.g., fatty liver).

  • Biomarker Development: Exploring FITM1 methylation signatures for disease prognosis, akin to human HCC studies .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
FITM1; FIT1; Fat storage-inducing transmembrane protein 1; Fat-inducing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FITM1
Target Protein Sequence
MERGPVVGAGRGAGARIRALLGGLVRVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSIHKHN
Uniprot No.

Target Background

Function
FITM1 plays a crucial role in the formation of lipid droplets (LDs), which act as storage organelles for lipid and energy homeostasis. It directly binds to diacylglycerol (DAGs) and triacylglycerol.
Database Links
Protein Families
FIT family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural topology of bovine FITM1 and how does it compare to FITM2?

FITM1 is a member of the evolutionarily conserved FIT protein family localized to the endoplasmic reticulum. Experimental topological studies using N-glycosylation site mapping and indirect immunofluorescence techniques have revealed that FITM1, like FITM2, has six transmembrane domains with both N- and C-termini localized to the cytosol . The key structural difference between FITM1 and FITM2 is that FITM1 (292 amino acids) has 30 extra amino acids at its N-terminus compared to FITM2 (262 amino acids) . This extra N-terminal segment comprises a hydrophobic tract that could potentially function as a cytosolic domain rather than a seventh transmembrane domain, as confirmed by glycosylation studies where an FNF tag at position 8 of FITM1 was not glycosylated, indicating its cytosolic localization .

What is the primary function of FITM1 in lipid metabolism?

FITM1 plays a crucial role in the formation of lipid droplets (LDs), which are storage organelles central to lipid and energy homeostasis . Unlike enzymes involved in triglyceride biosynthesis (such as diacylglycerol O-acyltransferases), FITM1 does not synthesize triglycerides but rather mediates their partitioning into lipid droplets . This has been demonstrated through experiments where FITM1 overexpression in HEK293 cells resulted in increased accumulation of radiolabeled triglycerides in isolated lipid droplets, despite no significant change in total cellular triglyceride synthesis . This function is achieved through FITM1's direct binding to triglycerides and diacylglycerols, facilitating their organization between the leaflets of the ER membrane during the nucleation step of de novo lipid droplet biogenesis .

How does the tissue distribution of FITM1 differ from that of FITM2?

FITM1 and FITM2 exhibit distinct tissue expression patterns, which suggests specialized functions:

  • FITM1 is expressed primarily in skeletal muscle

  • FITM2 is expressed primarily in adipose tissue, with high levels in both white and brown adipose tissue

  • FITM2 is also expressed across all mammalian tissues at varying levels

This differential expression pattern indicates that while both proteins participate in lipid droplet formation, they may serve tissue-specific roles. For researchers exploring the metabolic functions of these proteins, it is important to consider these tissue-specific expression patterns when designing in vitro and in vivo models to study FITM1 function .

What are the recommended methods for detecting and quantifying FITM1 protein expression in bovine tissue samples?

For comprehensive FITM1 detection and quantification in bovine tissue samples, researchers should consider a multi-method approach:

Western Blotting:

  • Use antibodies targeting the second luminal loop of FITM1 (as was done for FIT2)

  • Include proper controls such as recombinant FITM1 protein standards (ab165727)

  • Expected molecular weight: approximately 33 kDa for full-length bovine FITM1

  • Sample preparation should include detergent-based extraction (e.g., Fos-choline 13 buffer) that preserves membrane protein integrity

Quantitative PCR (qPCR):

  • Design primers specific to bovine FITM1 transcript

  • Compare expression across multiple tissues as demonstrated in PLIN1 studies (Figure 1A in reference )

  • Use reference genes like GAPDH or β-actin for normalization

Immunohistochemistry (IHC):

  • Utilize paraffin-embedded sections (5μm thickness)

  • Include antigen retrieval steps optimized for membrane proteins

  • Use DAB (3,3'-diaminobenzidine) for visualization

  • Include both positive controls (skeletal muscle) and negative controls

Expression Analysis Data Example:
When analyzing FITM1 expression across tissues, researchers typically present data in bar graphs showing relative expression levels normalized to a reference gene, similar to the approach used for PLIN1:

Tissue TypeRelative FITM1 Expression (a.u.)
Skeletal Muscle10.5 ± 1.2
Liver2.3 ± 0.4
Adipose1.8 ± 0.3
Heart4.7 ± 0.6
Other tissues<1.0

What are the optimal conditions for expressing and purifying recombinant bovine FITM1?

Based on protocols used for human FITM1 and related membrane proteins, the following methodology is recommended:

Expression Systems:

  • Wheat germ cell-free system (successfully used for human FITM1)

  • Alternative: HEK293 mammalian expression system with strong promoters (CMV)

  • Bacterial systems are generally less effective due to the membrane protein nature of FITM1

Expression Construct Design:

  • Include a C-terminal tag (V5, His6, or StrepII tag) for purification

  • Consider codon optimization for the expression system

  • Include TEV protease cleavage sites if tag removal is desired

Purification Protocol:

  • Cell lysis in detergent-containing buffer (e.g., Fos-choline 13)

  • Affinity chromatography using tag-specific resins

  • Size exclusion chromatography on Superdex 200 HR 10/30 column at 0.5 mL/min flow rate

  • Monitor purification by SDS-PAGE and Western blotting

  • Confirm protein folding via CD spectroscopy

Buffer Optimization:

  • For functional studies: buffer containing Fos-choline 13 detergent

  • For structural studies: consider nanodiscs or amphipols for stabilization

  • Typical buffer composition: 50 mM HEPES pH 7.4, 150 mM NaCl, 1 mM DTT, and appropriate detergent

Quality Control:

  • Assess purity by SDS-PAGE (>95% homogeneity)

  • Verify identity by mass spectrometry

  • Confirm functionality through lipid binding assays

How can I design experiments to measure FITM1's triglyceride binding capacity?

To quantitatively assess FITM1's triglyceride binding capacity, several complementary approaches can be implemented:

Direct Binding Assays with Radiolabeled Lipids:

  • Protocol Overview:

    • Purify FITM1 protein with appropriate tags (StrepII or His6)

    • Incubate with [³H]-tagged triolein (triglyceride)

    • Separate bound from free lipid using affinity resin

    • Quantify radioactivity in bound fraction

  • Key Parameters:

    • Lipid concentration range: 0-50 μM for saturation curves

    • Incubation time: ~4 hours at 4°C

    • Buffer composition: should contain appropriate detergent (Fos-choline 13)

    • Controls: include boiled/denatured protein as negative control

Competition Binding Assays:

  • Use radiolabeled triglyceride at fixed concentration

  • Add increasing concentrations of unlabeled lipids

  • Calculate IC50 values to determine binding specificity

Cell Culture-Based Binding Assays:

  • Express FITM1 in HEK293 cells

  • Extract in Fos-choline 13 buffer at 4°C

  • Immunoprecipitate using anti-tag antibodies

  • Perform standard binding assays with radiolabeled triglycerides

Data Analysis:

  • Calculate binding parameters (Kd, Bmax) using saturation binding curves

  • For example, wild-type FIT2 showed higher binding to triolein compared to FIT1

  • Present data as specific binding (pmol/mg protein) versus lipid concentration (μM)

Example Expected Results:
Based on findings with FIT1 and FIT2, researchers might expect:

ProteinMaximum [³H]-TAG Binding (relative units)Kd (μM)
FITM1~45% of FITM2Higher than FITM2
FITM2100% (reference)Lower than FITM1
FITM1 mutantsVariable depending on mutationVariable

How can FITM1 mutations be designed to investigate structure-function relationships?

Based on research with the related protein FIT2, strategic mutation design can provide valuable insights into FITM1's functional mechanisms:

Targeting Conserved Regions:

  • Focus on the "FIT signature sequence" in transmembrane domain 4, which contains the most highly conserved residues across the FIT family

  • The FLL sequence within this domain is particularly important - in FIT2, mutation of FLL(157-9)AAA resulted in a gain-of-function phenotype with larger lipid droplets

  • Consider analogous mutations in bovine FITM1's corresponding region

Functional Domains to Target:

  • Triglyceride Binding Sites:

    • N80 in FIT2 was identified as critical for triglyceride binding (N80A mutant showed ~55% reduction in binding)

    • Identify the homologous residue in FITM1 for mutation

    • Assess mutants using direct binding assays described in section 2.3

  • Transmembrane Domains:

    • Create alanine scanning libraries across all six transmembrane domains

    • Prioritize regions with high evolutionary conservation

    • For each mutant, assess:

      • Protein expression and localization (ensure ER targeting is maintained)

      • Lipid droplet formation capacity

      • Lipid binding properties

Conformational Change Assessment:

  • Use limited trypsin digestion to detect conformational changes in mutants

  • Generate antibodies to luminal loops for detecting trypsin-resistant fragments

  • Compare digestion patterns between wild-type and mutant FITM1

Experimental Pipeline:

  • Create mutant library using site-directed mutagenesis

  • Express in cell models (HEK293, muscle cells, or bovine cell lines)

  • Assess subcellular localization by immunofluorescence

  • Evaluate lipid droplet formation using BODIPY 493/503 staining

  • Quantify lipid droplet number and size using confocal microscopy and 3D rendering software

  • Conduct lipid binding assays with promising mutants

  • Perform limited proteolysis to detect conformational changes

What experimental approaches can be used to investigate FITM1's role in metabolic diseases?

FITM1's involvement in lipid metabolism suggests potential roles in various metabolic disorders. Based on recent research, the following experimental approaches are recommended:

Tissue-Specific Expression Analysis:

  • Compare FITM1 expression in normal versus diseased tissues (muscle, liver, adipose)

  • Methods: qPCR, Western blotting, and immunohistochemistry

  • Specifically investigate metabolic syndrome, lipodystrophy, and muscular disorders

Methylation Studies:

  • Investigate FITM1 promoter methylation status, as hypermethylation of FITM1 has been linked to hepatocellular carcinoma

  • Employ bisulfite sequencing or methylation-specific PCR

  • Correlate methylation levels with protein expression

  • Example data presentation format:

Tissue ConditionFITM1 Methylation β-valueFITM1 Expression (fold change)
Normal Tissue0.23 ± 0.051.00 (reference)
Diseased Tissue0.67 ± 0.080.21 ± 0.06

Knockout/Knockdown Models:

  • Generate tissue-specific FITM1 knockout mice (particularly in muscle)

  • Use siRNA or shRNA approaches in cell culture models

  • Assess metabolic parameters:

    • Lipid droplet formation (BODIPY staining)

    • Insulin sensitivity

    • Mitochondrial function

    • Exercise capacity (for muscle-specific studies)

    • Ceramide accumulation (LC-MS analysis)

Gain-of-Function Models:

  • Overexpress FITM1 in relevant cell types or tissues

  • Assess protection against lipotoxicity

  • Examine insulin signaling pathway components

  • Monitor changes in energy expenditure and substrate utilization

Disease-Associated Pathway Analysis:

  • Perform RNA-seq following FITM1 manipulation to identify affected pathways

  • Conduct Gene Set Enrichment Analysis (GSEA) to identify enriched pathways

  • Create a heatmap of differentially expressed genes

  • Validate key findings with qPCR and Western blotting

Clinical Correlation Studies:

  • Develop a FITM1-methylation signature for disease prognosis

  • Build risk models incorporating FITM1 status

  • Validate in independent patient cohorts

  • Example risk score formula based on FITM1 and related genes:
    Risk score = 4.37 × methylation of gene A - 9.31 × methylation of gene B + 9.61 × methylation of FITM1

How do FITM1 and FITM2 functionally interact in regulating lipid metabolism?

Despite their differential tissue expression, FITM1 and FITM2 share structural similarities and functional overlap. Understanding their interaction is crucial for comprehensive metabolic research:

Comparative Binding Studies:

  • FITM1 shows weaker binding to triglycerides and diacylglycerols compared to FITM2

  • This results in smaller lipid droplets formed by FITM1 compared to FITM2

  • Experimental approach: Directly compare binding affinities using competition assays with purified proteins

Co-expression Analysis:

  • Design experiments to express both FITM1 and FITM2 in varying ratios

  • Assess whether they:

    • Compete for the same substrates

    • Form heteromeric complexes

    • Have additive, synergistic, or antagonistic effects on lipid droplet formation

  • Use co-immunoprecipitation to detect potential protein-protein interactions

Tissue-Specific Regulation:

  • Investigate how FITM1 and FITM2 are differentially regulated in response to:

    • Nutritional status (fasting/feeding)

    • Exercise (particularly for muscle FITM1)

    • Hormonal stimulation (insulin, glucocorticoids)

    • Inflammatory signals

Compensatory Mechanisms:

  • In FITM1 knockout models, assess whether FITM2 expression is upregulated

  • Similarly, in FITM2-deficient models, examine FITM1 expression changes

  • Design rescue experiments: Can FITM1 overexpression compensate for FITM2 deficiency and vice versa?

Integrated Signaling Pathways:

  • Examine whether FITM1 and FITM2 are regulated by common or distinct upstream pathways

  • Assess downstream targets to identify shared and unique effectors

  • Potential experimental approach: Phosphoproteomic analysis following manipulation of each protein

Disease Context Comparative Analysis:

  • Compare the roles of FITM1 vs. FITM2 in:

    • Insulin resistance

    • Hepatic steatosis

    • Muscle metabolism

    • Cancer progression (FITM1 has been identified as a tumor suppressor in HCC)

How might FITM1 interact with other lipid droplet-associated proteins in coordinating cellular lipid metabolism?

FITM1 functions within a complex network of proteins involved in lipid droplet biology. Understanding these interactions presents opportunities for novel discoveries:

Key Interaction Partners to Investigate:

  • PLIN family proteins (especially PLIN1, which promotes lipid metabolism in adipocytes)

  • DGAT1 (based on HILPDA's interaction with DGAT1 in LD formation)

  • CIDEA, CIDEB, CIDEC

  • G0S2 and ABHD5

  • Seipin (forms part of the tripartite ER protein machinery with FITs for LD budding)

Experimental Approaches for Interaction Studies:

  • Co-immunoprecipitation:

    • Express tagged versions of FITM1 and potential partners

    • Perform reciprocal pulldowns to confirm interactions

    • Use crosslinking for transient interactions

  • Proximity Labeling:

    • Generate FITM1-BioID or FITM1-APEX2 fusion proteins

    • Identify proteins in close proximity to FITM1 in living cells

    • Validate hits with targeted co-localization studies

  • Förster Resonance Energy Transfer (FRET):

    • Similar to techniques used to demonstrate HILPDA interaction with DGAT1

    • Create fluorescent protein fusions (CFP/YFP pairs)

    • Measure FRET efficiency to quantify protein-protein interactions

  • Functional Cooperation Assays:

    • Co-express FITM1 with other LD proteins in cellular models

    • Assess synergistic or antagonistic effects on:

      • LD size and number

      • LD protein composition

      • Lipid composition using lipidomics approaches

Conceptual Model of Interactions:
Based on current knowledge, researchers might hypothesize a model where:

  • FITM1 binds triglycerides in the ER membrane

  • Seipins facilitate the organization of these lipids

  • PLINs coat forming droplets during budding

  • This coordinated action ensures proper LD formation and maturation

What are the mechanisms regulating FITM1 expression and activity in response to metabolic changes?

Understanding how FITM1 is regulated in different metabolic states could reveal its role in physiological adaptations:

Transcriptional Regulation:

  • Investigate potential transcription factors binding to FITM1 promoter

  • Examine epigenetic regulation (methylation has been shown to regulate FITM1 in HCC)

  • Study tissue-specific enhancers governing skeletal muscle expression

  • Methods:

    • ChIP-seq for transcription factor binding

    • Reporter assays with promoter constructs

    • ATAC-seq for chromatin accessibility

Post-Translational Modifications:

  • Investigate S-acylation (palmitoylation) of FITM1, which has been shown to regulate FITM2 stability

  • Examine phosphorylation sites using phospho-proteomic approaches

  • Study ubiquitination and proteasomal degradation pathways

  • Example protocol for palmitoylation studies:

    • Treat cells with palmitic acid

    • Assess FITM1 stability and degradation kinetics

    • Use hydroxylamine sensitivity to confirm palmitoylation

    • Identify modified residues by mass spectrometry

Metabolic Stimuli Impact:

  • Design experiments to assess FITM1 response to:

    • Fasting/feeding cycles

    • High-fat vs. low-fat diets

    • Exercise and muscle contraction

    • Insulin and other hormones

  • Measure both expression levels and activity (lipid droplet formation)

Structural Regulation:

  • Based on FIT2 studies, investigate conformational changes in FITM1

  • Use limited proteolysis assays to detect structural alterations

  • Develop antibodies to different domains for conformational studies

Integration with Energy Sensing Pathways:

  • Investigate connections to AMPK pathway

  • Study mTOR signaling effects on FITM1

  • Examine potential regulation by leptin, which plays a major role in energy homeostasis

How can contradictions in FITM1 research findings be reconciled through improved experimental design?

Researchers in the field sometimes encounter conflicting results regarding FITM1 function. These methodological considerations can help resolve discrepancies:

Common Sources of Experimental Variation:

  • Expression Level Differences:

    • Overexpression systems may produce non-physiological effects

    • Solution: Use inducible expression systems with titratable control

    • Include dose-response studies ranging from near-endogenous to high expression

  • Cell Type Specificity:

    • FITM1 function may differ between cell types

    • Solution: Study effects in relevant cell types (skeletal muscle cells for FITM1)

    • Compare results between primary cells, cell lines, and in vivo models

  • Species Differences:

    • Bovine FITM1 may have subtle functional differences from human or mouse orthologs

    • Solution: Perform direct side-by-side comparisons of orthologs

    • Use sequence alignment and homology modeling to predict functional differences

  • Methodological Inconsistencies:

    • Different lipid droplet quantification methods can yield varying results

    • Solution: Standardize LD analysis using:

      • Consistent staining protocols (BODIPY 493/503)

      • 3D confocal imaging rather than 2D

      • Automated quantification algorithms to reduce bias

      • Report both size and number distributions of LDs

Reconciliation Strategies:

  • Direct Replication Studies:

    • Design experiments that directly compare contradictory methods

    • Keep all variables constant except the one under investigation

    • Include positive and negative controls used in original studies

  • Multi-modal Analysis:

    • Employ complementary techniques to measure the same outcome

    • For lipid metabolism: combine microscopy, biochemical assays, and lipidomics

    • For protein function: combine binding assays, cellular phenotypes, and structural studies

  • Genetic Background Considerations:

    • Control for genetic background in animal and cellular models

    • Use CRISPR to create isogenic cell lines differing only in FITM1

    • Report complete genetic information in publications

  • Systematic Review Approach:

    • Create a comprehensive table comparing methodologies and outcomes across studies

    • Identify patterns that might explain discrepancies

    • Example format:

StudyModel SystemFITM1 Expression MethodLipid Droplet AnalysisKey FindingsPotential Confounding Factors
Study 1HEK293Transient transfection2D microscopyLarge LDsNon-physiological cell type
Study 2Muscle cellsStable integration3D confocalSmall LDsMore physiologically relevant
Study 3Mouse modelTissue-specific KOEM analysisMixed phenotypeCompensatory mechanisms

What are the key considerations when designing antibodies for bovine FITM1 detection?

Developing specific and sensitive antibodies for bovine FITM1 presents unique challenges:

Epitope Selection Strategies:

  • Target unique regions that differentiate FITM1 from FITM2

  • Focus on the N-terminal 30 amino acids unique to FITM1

  • For transmembrane proteins, target:

    • N- or C-terminal cytosolic domains

    • Second luminal loop (as successfully done for FIT2)

  • Avoid highly conserved regions if differentiation from FITM2 is needed

Antibody Validation Protocol:

  • Test antibody against recombinant FITM1 protein

  • Confirm specificity using FITM1 knockout/knockdown samples

  • Verify tissue distribution matches known FITM1 expression pattern

  • Perform peptide competition assays

  • Test cross-reactivity with FITM2 and other FIT family proteins

Recommended Antibody Types:

  • Monoclonal antibodies for high specificity applications

  • Polyclonal antibodies for robust detection across applications

  • Consider species-specific antibodies for bovine-specific research

Application-Specific Optimizations:

  • For Western blotting: Include membrane protein extraction protocols

  • For immunohistochemistry: Optimize fixation and antigen retrieval

  • For immunoprecipitation: Test various detergent conditions

  • For ELISA: Develop sandwich assay with complementary antibody pairs

Common Pitfalls and Solutions:

  • Low sensitivity: Use signal amplification methods

  • Background signal: Include extensive blocking steps

  • Conformational epitopes: Use native conditions where possible

  • Cross-reactivity: Pre-absorb antibodies against related proteins

How can lipid droplet dynamics be accurately quantified in FITM1 studies?

Accurate quantification of lipid droplets is crucial for assessing FITM1 function:

Advanced Imaging Techniques:

  • Confocal Z-stack Imaging:

    • Capture complete 3D information of cellular lipid droplets

    • Process using 3D rendering software (e.g., Velocity)

    • Quantify both number and volume of lipid droplets

  • Live-Cell Imaging:

    • Monitor real-time LD formation and dynamics

    • Use fluorescent fatty acids or neutral lipid dyes

    • Track movement, fusion, and growth of individual LDs

  • Super-Resolution Microscopy:

    • Improve spatial resolution beyond diffraction limit

    • Visualize LD-ER contact sites and FITM1 localization

    • Apply techniques such as STORM or PALM for protein localization

Quantitative Parameters to Measure:

  • LD number per cell

  • Size distribution (diameter/volume)

  • Total LD volume per cell

  • Subcellular distribution

  • Colocalization with ER or other organelles

  • Example quantification from FIT2 studies:

    ConstructMean LD Size (μm)LD Number/CellTG Content (fold over control)
    Mock0.2 ± 0.15.2 ± 2.11.0
    FITM10.8 ± 0.218.5 ± 3.72.3 ± 0.4
    FITM20.8 ± 0.223.7 ± 4.22.7 ± 0.5
    Mutantvaries by constructvaries by constructvaries by construct

Biochemical Quantification Methods:

  • Lipid Extraction and Analysis:

    • Extract cellular lipids using Folch or Bligh-Dyer methods

    • Quantify triglycerides using enzymatic assays or thin-layer chromatography

    • Perform advanced lipidomics with LC-MS/MS

  • Subcellular Fractionation:

    • Isolate pure LD fractions through ultracentrifugation

    • Quantify lipid and protein composition

    • Compare LD fractions between experimental conditions

Standardization Recommendations:

  • Include positive controls (DGAT2 overexpression) and negative controls (mock transfection)

  • Report multiple parameters (not just LD number)

  • Use consistent imaging settings and analysis algorithms

  • Conduct blind analysis to prevent bias

  • Verify microscopy findings with biochemical assays

What are the best cellular models for studying bovine FITM1 function in different contexts?

Selecting appropriate cellular models is critical for meaningful FITM1 research:

Muscle-Derived Models (Primary Choice for FITM1):

  • Bovine primary myoblasts/myotubes

  • C2C12 mouse myoblast cell line (for comparative studies)

  • L6 rat skeletal muscle cells

  • Advantages: Express FITM1 naturally, physiologically relevant

  • Culture considerations: Include differentiation protocols to form myotubes

Bovine-Specific Cell Lines:

  • MAC-T (bovine mammary epithelial cell line)

  • BFAECs (bovine aortic endothelial cells)

  • Bovine adipose-derived stem cells

  • Considerations: May require FITM1 overexpression systems

Non-Bovine Models for Mechanism Studies:

  • HEK293 cells: Widely used for FIT protein studies

  • 3T3-L1 adipocytes: For lipid metabolism studies

  • Hepatocytes: For liver metabolism and connections to HCC findings

  • Advantages: Well-characterized, easily manipulated

Experimental Design Considerations:

  • Expression Systems:

    • Transient vs. stable expression

    • Inducible systems for controlled expression

    • CRISPR-Cas9 for endogenous modification

  • Environmental Conditions:

    • Lipid supplementation protocols

    • Glucose concentration variations

    • Oxygen levels (normoxia vs. hypoxia)

    • Insulin sensitivity studies

  • Differentiation Protocols:

    • For muscle cells: Switch to low-serum media with horse serum

    • For adipocytes: Standard differentiation cocktail (IBMX, dexamethasone, insulin)

    • Monitor differentiation markers (MyoD, myogenin for muscle; PPARγ for adipocytes)

Model Selection Decision Matrix:

Research QuestionRecommended ModelJustificationKey Controls
Basic FITM1 functionHEK293Low endogenous FITM expression, easy manipulationMock transfection, FITM2 expression
Muscle-specific rolePrimary bovine myotubesPhysiological expression, relevant tissueCompare differentiated vs. undifferentiated
Disease mechanismsTissue-specific modelsContext-dependent effectsInclude disease-relevant conditions
Lipid metabolism3T3-L1 or bovine adipocytesRobust lipid droplet formationCompare with FITM2 effects

What are the most promising therapeutic applications targeting FITM1 pathways?

Based on current understanding of FITM1 biology, several therapeutic approaches show potential:

Metabolic Disorder Interventions:

  • Targeting FITM1 in skeletal muscle could modify intramuscular lipid storage

  • Potential applications in obesity, insulin resistance, and type 2 diabetes

  • Approaches could include:

    • Small molecule modulators of FITM1 activity

    • Gene therapy to restore FITM1 function in deficient states

    • Targeting upstream regulators of FITM1 expression

Cancer-Related Applications:

  • FITM1 has been identified as a tumor suppressor in non-viral hepatocellular carcinoma

  • Therapeutic approaches might include:

    • Demethylating agents to restore FITM1 expression

    • FITM1-based prognostic signatures for patient stratification

    • Combination therapies targeting FITM1 and related pathways

Muscle Disorders:

  • FITM1's predominant expression in skeletal muscle suggests potential roles in:

    • Muscular dystrophies

    • Mitochondrial myopathies

    • Exercise-induced adaptations

  • Therapeutic opportunities include modulating muscle lipid storage to improve function

Approach Validation Steps:

  • Develop high-throughput screening assays for FITM1 modulators

  • Validate hits in cellular and animal models

  • Assess effects on comprehensive metabolic parameters

  • Evaluate safety and specificity profiles

  • Pursue translational studies in relevant disease models

What are the current knowledge gaps that require further investigation in FITM1 research?

Despite significant advances, several important questions remain unanswered:

Structural Biology:

  • No high-resolution structure of FITM1 is currently available

  • Key questions include:

    • How does FITM1 bind triglycerides at the molecular level?

    • What conformational changes occur during lipid binding?

    • How do the six transmembrane domains organize to create a functional protein?

Physiological Regulation:

  • Limited understanding of how FITM1 is regulated in response to:

    • Exercise and physical activity

    • Nutritional status

    • Hormonal signals

    • Inflammatory conditions

    • Aging

Disease Associations:

  • Need for comprehensive analysis of FITM1 involvement in:

    • Muscle-specific disorders

    • Metabolic diseases beyond HCC

    • Potential roles in neurodegenerative conditions (given lipid metabolism connections)

Comparative Biology:

  • Limited studies directly comparing bovine FITM1 with other species

  • Evolutionary analysis of FITM1 function across diverse animal models

  • Species-specific adaptations in muscle lipid metabolism

Technological Limitations:

  • Need for better tools including:

    • Bovine-specific antibodies

    • Tissue-specific conditional knockout models

    • Real-time activity sensors for FITM1

    • High-resolution imaging of FITM1 dynamics

Research Priority Recommendations:

  • Development of structural models for FITM1

  • Creation of tissue-specific knockout models to assess physiological roles

  • Investigation of FITM1 regulation in response to exercise and nutrition

  • Comparative studies across species

  • Exploration of potential therapeutic applications in metabolic diseases

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.