Recombinant Bovine Fatty acid desaturase 2 (FADS2)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Function

FADS2 is a membrane-bound endoplasmic reticulum protein belonging to the fatty acid desaturase family. Structurally, it contains:

  • A cytochrome b5-like domain at the N-terminus for electron transfer .

  • Three histidine-rich motifs in the C-terminal desaturase domain, essential for catalytic activity .

  • The ability to introduce double bonds at specific positions (e.g., Δ6, Δ4) in fatty acid chains, converting linoleic acid (LA; 18:2n-6) and α-linolenic acid (ALA; 18:3n-3) into γ-linolenic acid (GLA; 18:3n-6) and stearidonic acid (SDA; 18:4n-3), respectively .

In bovines, FADS2 is encoded by the FADS2 gene on chromosome 29 and is a rate-limiting enzyme in LC-PUFA biosynthesis .

Production Methods

Recombinant bovine FADS2 is produced using heterologous expression systems. Key platforms include:

Host SystemYieldPurityAdvantages
Escherichia coliModerate≥85% Cost-effective; rapid production
Baculovirus/Insect CellsHigh≥85% Proper post-translational modifications
Mammalian CellsLow≥85% Native-like folding and activity

These systems enable large-scale production for biochemical assays, structural studies, and industrial applications .

Functional Characteristics

Recombinant bovine FADS2 exhibits the following enzymatic properties:

  • Substrate Specificity: Primarily acts on C18 fatty acids (LA, ALA) but can also desaturate C22 precursors (e.g., 22:5n-3 → 22:6n-3) .

  • Kinetics: Acts as a Δ6-desaturase in most vertebrates, but Δ4-desaturase activity has been observed in teleost fish and human cell lines .

  • Regulation: Expression is modulated by dietary PUFA intake, hormonal signals, and genetic polymorphisms .

Genetic Polymorphisms and Milk Fatty Acid Composition

Studies in dairy cattle have linked FADS2 polymorphisms to milk fat profiles:

BreedPolymorphism (rs209202414)Associated Fatty AcidsP-value
JerseyA-to-G in intron 3Lauric, behenic, lignoceric acids0.0486–0.0209
Polish Holstein-FriesianA-to-G in intron 3Erucic acid, docosahexaenoic acid (DHA)0.0460–0.0469

These SNPs influence fatty acid elongation and desaturation efficiency, impacting milk nutritional quality .

Role in LC-PUFA Biosynthesis

  • Knockout studies in mice show that FADS2 deficiency disrupts LC-PUFA synthesis, leading to membrane lipid abnormalities and metabolic dysfunction .

  • In bovines, FADS2 activity directly affects the ratio of omega-3 to omega-6 fatty acids in milk and meat, with implications for human health .

Applications

  1. Agricultural Biotechnology: Enhancing FADS2 expression in livestock could improve LC-PUFA content in dairy and meat products .

  2. Disease Research: Used to model lipid metabolism disorders and explore therapeutic targets for cardiovascular diseases .

  3. Industrial Enzymology: Optimized recombinant FADS2 variants are being tested for scalable production of omega-3 supplements .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
FADS2; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MGKGGNQDEGATELEAPMPTFRWEEIQKHNLRTDKWLVIDRKVYNITKWSSRHPGGQRVI GHYAGEDATDAFLAFHRNLDFVRKFMKPLLIGELAPEEPSQDRGKNSQITEDFRALRKTA EDMNLFKSNQLFFLLHLAHIIAMESIAWFTLFYFGNGWIPTIITAFVLATSQAQAGWLQH DYGHLSVYKKSMWNHIVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPLYFQYQIIMTMIVRKYWADLAWAI SYYTRFFITYIPFYGVLGSILFLNFIRFLESHWFVWVTQMNHIVMEIDREPYRDWFSSQL AATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVRSLCAKHGIEYQEKPLL RALQDIIGSLRKSGQLWLDAYLHK
Uniprot No.

Target Background

Function
Recombinant Bovine Fatty acid desaturase 2 (FADS2) plays a crucial role in the biosynthesis of highly unsaturated fatty acids (HUFA) from essential polyunsaturated fatty acids (PUFA) precursors, namely linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). It functions as a fatty acyl-coenzyme A (CoA) desaturase, introducing a cis double bond at carbon 6 of the fatty acyl chain. This enzyme catalyzes the initial and rate-limiting step in this pathway, converting LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. Subsequently, in the biosynthetic pathway of HUFA n-3 series, it desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is further converted to docosahexaenoate (DHA)(22:6n-3), a critical lipid for nervous system function. This enzyme can also desaturate (11E)-octadecenoate (trans-vaccenoate, a metabolite in the biohydrogenation pathway of LA and the predominant trans fatty acid in cow milk) at carbon 6, generating (6Z,11E)-octadecadienoate. In addition to Delta-6 activity, this enzyme exhibits Delta-8 activity with a slight preference toward n-3 fatty acyl-CoA substrates.
Database Links

KEGG: bta:521822

STRING: 9913.ENSBTAP00000020610

UniGene: Bt.3891

Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of bovine Fatty Acid Desaturase 2 (FADS2) in lipid metabolism?

Bovine Fatty Acid Desaturase 2 (FADS2) plays a pivotal role in the biosynthesis of polyunsaturated fatty acids (PUFAs). The enzyme specifically catalyzes the introduction of double bonds at the sixth carbon atom in a variety of fatty acid substrates. FADS2 is the only enzyme that catalyzes this crucial step in the conversion of essential fatty acids linoleic acid (C18:2n-6) and α-linolenic acid (C18:3n-3) to n-6/n-3 long-chain polyunsaturated fatty acids (LC-PUFAs) .

How does the genomic structure of bovine FADS2 compare to its human ortholog?

This difference in conservation suggests that transcription factor binding sites may differ between human and bovine species, which could influence gene regulation patterns. Additionally, in both species, genetic variants within the FADS2 intronic regions can affect the expression of other genes within the FADS cluster, particularly FADS1, indicating complex regulatory interrelationships within this gene family that transcend species boundaries .

What are the common polymorphisms identified in bovine FADS2 and their functional significance?

Research on Chinese Holstein cows has identified three significant single nucleotide polymorphisms (SNPs) in the bovine FADS2 gene:

SNPLocationNucleotide ChangeAmino Acid ChangeFunctional Significance
rs211580559Exon 7c.908 C > Tp.Ala294Val (missense)Associated with higher milk, fat, and protein yields
rs2101693033' UTRc.1571 G > ANone (regulatory)Located within binding site for bta-miR-744; A allele abolishes miR-744 binding
rs2079320033' UTRc.2776 A > GNone (regulatory)Potential regulatory effects

The SNP c.908 C > T is particularly significant as it not only correlates with increased milk production parameters but also shows a significant association with decreased somatic cell score (SCS), suggesting improved resistance against mastitis. This dual benefit makes this polymorphism particularly valuable for dairy cattle breeding programs focused on both production and health traits .

How can researchers effectively express recombinant bovine FADS2 in heterologous systems?

For successful heterologous expression of recombinant bovine FADS2, a multi-step methodology is recommended:

  • Vector Selection and Design:

    • For mammalian expression, pCDNA3.1(+) vectors with CMV promoters show optimal expression

    • For bacterial expression, pET vectors with N-terminal His-tags facilitate purification while maintaining enzyme activity

  • Expression System Optimization:

    • Mammalian cell lines (CHO or HEK293) yield properly folded, active enzyme with appropriate post-translational modifications

    • Insect cell systems (Sf9) provide higher yields while maintaining most mammalian-type modifications

    • Bacterial systems require careful optimization of induction conditions (16°C, 0.1mM IPTG) to prevent inclusion body formation

  • Verification Protocol:

    • Western blot using anti-FADS2 antibodies

    • Activity assay measuring conversion of linoleic acid (18:2n-6) to γ-linolenic acid (18:3n-6) by GC-MS analysis

    • Verification of protein localization to the endoplasmic reticulum membrane with fluorescent tags

When optimizing expression conditions, researchers should monitor the impact of temperature, induction time, and cofactor availability (NADH/NADPH) on enzyme activity. Membrane protein expression requires specific detergents for solubilization; n-dodecyl β-D-maltoside (DDM) at 1% concentration generally preserves FADS2 activity while enabling purification .

What methodologies are most effective for analyzing FADS2 expression in bovine tissues?

For comprehensive analysis of FADS2 expression in bovine tissues, a multi-platform approach yields the most reliable results:

  • Transcriptional Analysis:

    • Quantitative PCR (qPCR) using validated bovine FADS2-specific primers

    • RNA-Seq for genome-wide expression pattern analysis

    • Primer design must account for alternative splice variants reported in bovine tissues

  • Protein Level Analysis:

    • Western blotting with validated antibodies specific to bovine FADS2

    • Immunohistochemistry for tissue localization studies

    • Enzymatic activity assays measuring desaturation of specific substrates

  • Genotype-Expression Correlation:

    • MassARRAY system for SNP genotyping with high throughput capabilities

    • Combined analysis of genotype and expression data using linear regression models

    • Investigation of tissue-specific eQTLs (expression Quantitative Trait Loci)

When analyzing FADS2 expression, tissue collection timing is critical as FADS2 expression varies significantly during different physiological states, particularly in postpartum dairy cattle experiencing negative energy balance. Studies have demonstrated that FADS2 is significantly downregulated during this period in liver tissue, suggesting its important role in metabolic adaptation .

How can researchers effectively analyze the impact of FADS2 genetic variants on milk production traits?

To effectively analyze the association between FADS2 genetic variants and milk production traits, researchers should implement the following methodological approach:

  • Study Design Considerations:

    • Minimum sample size of 500-1000 animals for sufficient statistical power

    • Longitudinal data collection across multiple lactations

    • Account for environmental factors and herd effects using mixed models

  • Genotyping Methodology:

    • Whole-gene sequencing to identify all variants rather than candidate SNP approaches

    • High-throughput platforms such as MassARRAY systems for large-scale studies

    • Quality control measures including Hardy-Weinberg equilibrium testing

  • Statistical Analysis Framework:

    • Mixed model approaches that account for repeated measures and random effects

    • Haplotype analysis rather than single SNP analysis where possible

    • Correction for multiple testing using Benjamini-Hochberg method

A comprehensive association study conducted with Chinese Holstein cows revealed significant associations between FADS2 SNPs and milk production traits. The SNP c.908 C > T demonstrated particularly strong associations with milk yield, fat yield, and protein yield. The following table summarizes the estimated effects of this SNP on production traits :

GenotypeMilk Yield (kg)Fat Yield (kg)Protein Yield (kg)Somatic Cell Score
CCBaselineBaselineBaselineBaseline
CT+243.52+9.41+7.48-0.27
TT+419.77+15.83+12.64-0.41

These findings demonstrate that the T allele is associated with significantly improved production parameters and reduced somatic cell score, indicating potential benefits for both milk production and mastitis resistance .

What is the relationship between bovine FADS2 function and fatty acid composition in milk?

The relationship between bovine FADS2 function and milk fatty acid composition is complex and multifaceted:

Methodologically, researchers studying this relationship should employ gas chromatography-mass spectrometry (GC-MS) or high-performance liquid chromatography (HPLC) for accurate fatty acid profiling, coupled with genotyping and expression analysis of FADS2 variants.

How does FADS2 expression in bovine brain tissue relate to cognitive function and development?

The relationship between FADS2 expression in bovine brain tissue and cognitive function represents an emerging area of research with significant implications:

  • Brain Region-Specific Expression Patterns:
    FADS2 expression varies across different brain regions, with distinct expression profiles in the prefrontal cortex compared to whole brain tissue. This regional specificity suggests differing functional roles in various brain circuits. Mendelian randomization studies have examined the causal relationship between FADS1/FADS2 expression in brain tissues and cognitive function .

  • Mechanistic Pathways:
    FADS2 facilitates the conversion of essential fatty acids to LC-PUFAs, particularly arachidonic acid and docosahexaenoic acid (DHA), which are critical components of neuronal membranes and myelin sheaths. These LC-PUFAs regulate membrane fluidity, neuronal signaling, and synaptogenesis, thereby influencing cognitive processes. Research in mice has demonstrated that genetic variants in the FADS cluster region affect FADS1 and FADS2 expression in the prefrontal cortex, a brain region critical for complex cognitive functions .

  • Genetic Associations:
    Genetic variants in the FADS2 gene have been associated with altered expression patterns that impact cognitive development. Studies in mice have shown that genetic variants in FADS2 intronic regions affect FADS1 expression in the whole brain (p-value < 1.9E-03) and FADS2 expression in the prefrontal cortex (p-value < 0.0008) .

Methodologically, researchers investigating these relationships should consider:

  • Tissue-specific expression analysis using RNA-seq or qPCR

  • Genetic colocalization analysis to examine shared causal variants between FADS expression and cognitive traits

  • Functional validation using in vitro models or transgenic animal models

What are the optimal conditions for enzymatic activity assays of recombinant bovine FADS2?

For optimal enzymatic activity assays of recombinant bovine FADS2, researchers should consider the following methodological parameters:

  • Buffer Composition:

    • 50 mM Tris-HCl (pH 7.4)

    • 1 mM NADH or NADPH (as electron donor)

    • 2 mM MgCl₂

    • 0.5 mM DTT (to maintain reducing environment)

    • 0.1% (w/v) n-dodecyl β-D-maltoside (for membrane protein solubilization)

  • Substrate Preparation:

    • Linoleic acid (C18:2n-6) or α-linolenic acid (C18:3n-3) complexed with BSA (3:1 molar ratio)

    • Substrate concentration range: 10-100 μM

    • Pre-solubilization in ethanol (<1% final concentration)

  • Reaction Conditions:

    • Temperature: 37°C (optimal for bovine enzyme)

    • Reaction time: 30-60 minutes

    • Agitation: Gentle shaking (100 rpm)

    • Terminate reaction with 3:2 (v/v) methanol:chloroform

  • Product Analysis:

    • Extraction of fatty acids using Folch method

    • Methylation using boron trifluoride-methanol

    • Analysis by gas chromatography-mass spectrometry

    • Quantification against authenticated standards

When optimizing these assays, researchers should be aware that recombinant bovine FADS2 activity can be significantly affected by the expression system used. Enzymatic activity is typically highest when expressed in mammalian or insect cell systems that provide proper post-translational modifications and membrane integration compared to bacterial expression systems .

How can researchers effectively knockdown or knockout FADS2 in bovine cell models?

For effective manipulation of FADS2 expression in bovine cell models, researchers can employ several complementary approaches:

  • CRISPR-Cas9 Gene Editing:

    • Design guide RNAs targeting conserved exonic regions of bovine FADS2

    • For complete knockout: target early exons (exons 1-3) to maximize functional disruption

    • For specific polymorphism studies: use homology-directed repair with donor templates

    • Validation: genomic sequencing and Western blot analysis

  • RNA Interference Approaches:

    • siRNA design: 21-23 nucleotide duplexes targeting bovine FADS2-specific sequences

    • shRNA for stable knockdown: cloning into lentiviral vectors for long-term studies

    • Transfection optimization: lipid-based methods for bovine mammary epithelial cells

    • Validation: qRT-PCR and Western blot (reduction typically 70-90%)

  • Antisense Oligonucleotides:

    • Phosphorothioate-modified oligonucleotides for enhanced stability

    • Target FADS2 mRNA regions with minimal secondary structure

    • Dosage: typically 50-200 nM depending on cell type

    • Time course: assess knockdown at 24, 48, and 72 hours post-transfection

When implementing these approaches in bovine cell models such as mammary epithelial cells (MEC) or hepatocytes, researchers should carefully optimize transfection conditions as bovine cells often show lower transfection efficiency compared to standard laboratory cell lines. Additionally, phenotypic analysis should include comprehensive fatty acid profiling to confirm functional consequences of FADS2 disruption, particularly focusing on the conversion of essential fatty acids to their long-chain polyunsaturated derivatives .

What analytical techniques are most reliable for determining FADS2 substrate specificity and enzyme kinetics?

For comprehensive characterization of bovine FADS2 substrate specificity and enzyme kinetics, researchers should employ a multi-analytical approach:

  • Substrate Specificity Assessment:

    • Competitive Substrate Assays: Simultaneous presentation of multiple substrates (C16-C22 fatty acids) to determine preferential desaturation

    • Radioisotope Labeling: Use of [14C]-labeled fatty acids to track conversion rates with high sensitivity

    • LC-MS/MS Analysis: High-resolution mass spectrometry to identify and quantify desaturation products across various substrate types

  • Enzyme Kinetics Determination:

    • Michaelis-Menten Parameters: Determine Km and Vmax using substrate concentration ranges of 5-100 μM

    • Lineweaver-Burk Plots: For visualization of kinetic parameters and identification of inhibition patterns

    • Spectrophotometric Continuous Assays: Monitor NADH/NADPH oxidation at 340 nm as a proxy for desaturase activity

  • Structure-Function Analysis:

    • Site-Directed Mutagenesis: Systematic mutation of conserved histidine residues in the catalytic domain

    • Homology Modeling: Computational prediction of substrate binding sites based on crystallized membrane desaturases

    • Inhibitor Studies: Use of specific desaturase inhibitors (e.g., sterculic acid) to probe active site properties

For accurate kinetic analysis, researchers should ensure that substrate availability is not limiting by using appropriate detergent systems and albumin:fatty acid ratios. Additionally, enzyme concentration should be optimized to ensure initial velocity conditions throughout the assay period .

Studies with bovine FADS2 have demonstrated that the enzyme shows highest activity toward linoleic acid (C18:2n-6) and α-linolenic acid (C18:3n-3), with Km values typically in the range of 15-25 μM. The substrate chain length and existing desaturation pattern significantly influence the catalytic efficiency (kcat/Km) .

How can researchers effectively analyze the regulatory mechanisms controlling FADS2 gene expression?

To comprehensively analyze the regulatory mechanisms controlling bovine FADS2 gene expression, researchers should implement the following methodological approaches:

  • Promoter Analysis and Transcriptional Regulation:

    • Luciferase Reporter Assays: Construct reporter vectors containing different lengths of the FADS2 promoter region to identify key regulatory elements

    • ChIP-Seq Analysis: Identify transcription factor binding sites in the FADS2 promoter under different physiological conditions

    • EMSA (Electrophoretic Mobility Shift Assay): Confirm specific transcription factor binding to regulatory elements

    • Deletion/Mutation Analysis: Systematic mutation of predicted binding sites to confirm functional importance

  • Post-Transcriptional Regulation:

    • miRNA Analysis: Identify miRNA binding sites in the 3' UTR region using computational prediction and experimental validation

    • RNA Stability Assays: Measure FADS2 mRNA half-life using actinomycin D chase experiments

    • RNA Immunoprecipitation: Identify RNA-binding proteins that regulate FADS2 mRNA stability or translation

  • Epigenetic Regulation:

    • DNA Methylation Analysis: Bisulfite sequencing of the FADS2 promoter region

    • Histone Modification Profiling: ChIP assays for activating (H3K4me3) and repressive (H3K27me3) marks

    • Chromatin Accessibility: ATAC-seq to identify open chromatin regions in the FADS2 locus

  • Genetic Variant Impact Analysis:

    • eQTL Analysis: Correlate SNPs with FADS2 expression levels in relevant tissues

    • Allele-Specific Expression: Determine if genetic variants cause allelic imbalance in FADS2 expression

    • CRISPR-mediated SNP Editing: Functional validation of variant effects on expression

Research has shown that the bovine FADS2 contains functional SNPs in the 3' UTR region that affect microRNA binding. Specifically, the SNP c.1571 G > A (rs210169303) is located within the binding site for bta-miR-744, with the minor allele A abolishing the ability of miR-744 to bind to FADS2 . This highlights the importance of post-transcriptional regulation in controlling FADS2 expression levels.

How can FADS2 genetic information be effectively incorporated into dairy cattle breeding programs?

Incorporating FADS2 genetic information into dairy cattle breeding programs requires a systematic approach:

  • Marker-Assisted Selection Implementation:

    • SNP Prioritization: Focus on functional variants with demonstrated phenotypic effects (c.908 C > T)

    • Custom Genotyping Panels: Develop cost-effective SNP panels including FADS2 variants alongside other production markers

    • Breeding Value Estimation: Integrate FADS2 genotypes into genomic selection models with appropriate economic weights

  • Multi-Trait Selection Strategy:

    • Index Development: Create selection indices that balance FADS2-related traits (milk composition, health traits) with other production goals

    • Correlation Analysis: Account for potential antagonistic genetic correlations between FADS2-influenced traits and other breeding objectives

    • Economic Weighting: Assign economic values to FADS2-related traits based on market demands for milk composition

  • Practical Implementation Considerations:

    • Breed Specificity: Validate FADS2 marker effects across different cattle breeds before implementation

    • Genotyping Infrastructure: Establish routine genotyping protocols for large-scale screening

    • Data Integration: Develop databases that link genotypic information with phenotypic records and pedigree information

Research has demonstrated that the T allele of SNP c.908 C > T is associated with multiple beneficial traits, including higher milk yield (+419.77 kg for TT genotype), increased fat and protein yields, and improved somatic cell score (indicating better mastitis resistance) . This multi-trait improvement potential makes FADS2 particularly valuable for breeding programs seeking to balance production and health traits.

When implementing selection for FADS2 variants, breeders should monitor potential impacts on other traits not directly measured, particularly reproductive traits, to avoid unintended consequences of selection.

What are the implications of FADS2 research for understanding the nutritional quality of dairy products?

The implications of FADS2 research for dairy product nutritional quality are substantial and multifaceted:

  • Fatty Acid Profile Optimization:

    • FADS2 genetic variants influence the conversion of essential fatty acids to long-chain polyunsaturated fatty acids (LC-PUFAs)

    • This directly impacts the omega-3:omega-6 ratio in milk, which has significant nutritional implications

    • Research suggests that specific FADS2 genotypes could increase the concentration of beneficial LC-PUFAs like arachidonic acid and docosahexaenoic acid (DHA) in milk

  • Health-Promoting Properties:

    • The LC-PUFAs produced through FADS2 activity have documented anti-inflammatory properties

    • Higher levels of these fatty acids in dairy products may contribute to improved cardiovascular health metrics in consumers

    • Research indicates potential benefits for brain development when infant formulas contain milk from cows with specific FADS2 variants

  • Product Development Opportunities:

    • Milk from cows with favorable FADS2 genotypes could be segregated for production of premium, nutritionally-enhanced dairy products

    • Potential for developing specialty products with verified fatty acid profiles based on supplier herd genotypes

    • Methodologies for tracking and verifying fatty acid composition through the production chain

  • Research Directions:

    • Integration of FADS2 genotyping with feeding strategies to optimize fatty acid profiles

    • Investigation of how processing technologies affect the retention of FADS2-influenced beneficial fatty acids

    • Development of rapid screening methods for fatty acid composition in commercial settings

The relationship between FADS2 activity and α-linolenic acid (ALA) metabolism is particularly noteworthy for dairy product quality. Research has shown that ALA supplementation in dairy goats leads to decreased somatic cell count , suggesting that modulation of FADS2 activity could potentially improve both the nutritional quality and production parameters simultaneously.

How does FADS2 research contribute to addressing metabolic disorders in dairy cattle?

FADS2 research provides significant insights into metabolic disorders in dairy cattle, particularly those related to the transition period and lipid metabolism dysfunction:

The research implications extend to practical applications, where monitoring FADS2 expression or activity could serve as a biomarker for metabolic health, potentially allowing for earlier intervention in subclinical metabolic disorders. Additionally, nutritional strategies designed to complement particular FADS2 genotypes could be developed to mitigate metabolic challenges during the transition period.

What emerging technologies show promise for advancing bovine FADS2 research?

Several cutting-edge technologies are poised to significantly advance bovine FADS2 research:

  • CRISPR-Cas9 Precision Engineering:

    • Base editing technologies for introducing specific FADS2 polymorphisms without double-strand breaks

    • Epigenome editing to modulate FADS2 expression without altering sequence

    • In vivo CRISPR delivery systems for tissue-specific modification in adult cattle

    • These approaches allow precise manipulation of FADS2 genetic variants to validate functional effects in live animals

  • Single-Cell Transcriptomics:

    • Cell-type specific FADS2 expression patterns across diverse bovine tissues

    • Identification of rare cell populations with unique FADS2 regulatory mechanisms

    • Trajectory analysis to understand FADS2 expression dynamics during development and lactation

    • These methods provide unprecedented resolution of FADS2 regulation in heterogeneous tissues

  • Metabolomics Integration:

    • Untargeted lipidomics to identify comprehensive downstream effects of FADS2 variation

    • Stable isotope tracing to map dynamic fatty acid metabolism pathways

    • Multi-omics data integration to correlate FADS2 genotype, expression, and metabolite profiles

    • These approaches reveal functional consequences of FADS2 variants at the metabolic level

  • Structural Biology Advances:

    • Cryo-electron microscopy for membrane protein structural determination

    • Computational modeling of bovine FADS2 structure and substrate interactions

    • Structure-guided design of specific FADS2 modulators

    • These technologies provide molecular-level understanding of FADS2 function and regulation

For researchers seeking to implement these technologies, collaborative approaches with specialized facilities are recommended, particularly for expensive technologies like cryo-EM or single-cell sequencing. Additionally, computational resources for analyzing the resulting complex datasets should be secured in advance of experimental work .

How might FADS2 research findings be translated to address complex challenges in dairy production systems?

The translation of FADS2 research findings to practical dairy production systems involves multiple interconnected pathways:

  • Precision Breeding Applications:

    • Development of high-throughput, cost-effective genotyping platforms specifically including functional FADS2 variants

    • Integration of FADS2 genetic information into comprehensive selection indices that balance production, health, and product quality traits

    • Breed-specific validation of FADS2 marker effects to ensure applicability across diverse production systems

    • These approaches allow systematic improvement of herds through informed breeding decisions

  • Nutritional Intervention Strategies:

    • Formulation of precision diets based on animal FADS2 genotype to optimize metabolic efficiency

    • Development of feeding regimens that complement specific FADS2 variants to enhance beneficial fatty acid profiles in milk

    • Seasonal adjustment of feed composition to counteract environmental effects on FADS2 expression

    • These nutritional approaches maximize the genetic potential encoded by favorable FADS2 variants

  • Monitoring and Management Tools:

    • Development of rapid, on-farm testing for fatty acid profiles as indicators of FADS2 function

    • Integration of FADS2-related biomarkers into early warning systems for metabolic disorders

    • Decision support tools that recommend management interventions based on FADS2 genotype and current physiological status

    • These monitoring systems facilitate timely, targeted interventions to prevent production losses

  • Value-Added Product Development:

    • Creation of specialty dairy products with enhanced nutritional profiles based on FADS2-influenced fatty acid composition

    • Development of verification systems to certify fatty acid profiles in premium products

    • Market education programs highlighting the health benefits of optimized fatty acid profiles

    • These product initiatives create economic incentives for adopting FADS2-informed breeding and management

The research demonstrating that the T allele of SNP c.908 C > T is associated with both improved production parameters and reduced somatic cell score provides a particularly compelling case for practical implementation, as it addresses both economic production goals and animal welfare concerns simultaneously.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.