Recombinant Bovine Fatty acid desaturase 3 (FADS3)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Functional Domains

Bovine FADS3 is a 51,306 Da protein encoded by the FADS3 gene (UniProt: A4IFP3, NCBI Gene ID: 515925) . Its structure includes:

  • N-terminal cytochrome b5-like domain: Facilitates electron transfer during desaturation.

  • C-terminal transmembrane desaturase domain: Contains three conserved histidine motifs essential for catalytic activity .

  • Multi-pass membrane protein: Localized to the endoplasmic reticulum, where fatty acid modification occurs .

FADS3 is distinct from FADS1 (Δ5-desaturase) and FADS2 (Δ6-desaturase) but shares 52–62% sequence homology with them . Unlike its paralogs, FADS3 exhibits unique substrate specificity, including Δ13-desaturation of trans-vaccenic acid to produce conjugated linoleic acid (CLA) and Δ14Z-desaturation of sphingoid bases .

Production of Recombinant Bovine FADS3

Recombinant bovine FADS3 is generated using advanced biotechnological methods:

  • CRISPR-Cas9 and SCNT: Codon-optimized Fad3 sequences were integrated into bovine fibroblast cells via CRISPR-Cas9, followed by somatic cell nuclear transfer (SCNT) to create transgenic cattle .

  • Expression Systems: Common platforms include mammalian cell lines (HEK293), E. coli, and cell-free systems, though bovine-specific applications prioritize mammalian systems for post-translational modifications .

Table 1: Key Metrics in Transgenic Cattle Production

ParameterValue (%)
Pregnancy success (60 days)18.8
Live births9.4
Survival rate1.9

Fatty Acid Modification

Recombinant FADS3 significantly alters fatty acid profiles:

  • n-3 PUFA Enrichment: Transgenic cattle showed a 12.5-fold increase in n-3 polyunsaturated fatty acids (PUFAs), reducing the n-6/n-3 ratio from 34.84 to 2.78 (p < 0.01) .

  • Substrate Specificity:

    • Converts trans-vaccenic acid to trans11,cis13-CLA .

    • Desaturates sphingoid bases (e.g., d18:1 to d18:2) via Δ14Z activity, modulating sphingolipid metabolism .

Enzymatic Activity Validation

  • In vitro assays: HEK293 cells expressing FADS3 demonstrated a 70% increase in d18:2 sphingoid bases compared to controls .

  • ELISA Quantification: Commercial kits (e.g., Assay Genie BOEB0206) enable precise measurement of FADS3 levels in serum, plasma, and tissues, with intra- and inter-assay CVs < 10% .

Agricultural Biotechnology

  • Meat Quality Enhancement: Transgenic cattle with recombinant FADS3 produce beef enriched in n-3 PUFAs, aligning with dietary recommendations for cardiovascular health .

  • Metabolic Studies: FADS3 modulates the AKT and PPAR signaling pathways, influencing glycolipid metabolism and mitochondrial function .

Disease Research

  • Lipid Homeostasis: FADS3 polymorphisms correlate with cholesterol and triglyceride levels, suggesting roles in metabolic disorders .

  • Cancer and Inflammation: Located on chromosome 11q13 (a cancer hotspot), FADS3 expression is regulated by transcription factors like NF-κB and p63, linking it to cell survival mechanisms .

  • Unresolved Mechanisms: The interaction between recombinant FADS3 and endogenous bovine genes remains poorly understood .

  • Enzymatic Diversity: While FADS3’s Δ13- and Δ14Z-desaturase activities are established, its full catalytic range and physiological impact require further exploration .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please contact your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
FADS3; Fatty acid desaturase 3; Delta(13 fatty acid desaturase; Delta(13 desaturase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
FADS3
Target Protein Sequence
MGGVGEPDWEPGQRGAPLPTLRWEQVRRHNLPGDKWLVIERRVYDISRWAQRHPGGSRLI GHHGAEDATDAFHAFHQDLSFVRKFLQPLLIGELAPEEPSQDGPQNTQLIEDFRALRQAV EDMKLFEAKPAFFGLLLGHILAMEVLAWLMIYMLGPGWVPSTLAALILAISQAQSWCLQH DLGHTSIFRNSRWNHLAQQFVMGQLKGFSAHWWNFRHFQHHAKPNIFHKDPDVTVAPVFL LGESSVEYGKKKRRYLPYNHQHLYFFLIGPPLLTLVNFEVENLAYMLVCMQWMDLLWAAS FYARFLLSYIPFYGIPGALLLFVAVRVLESHWFVWITQMNHIPREIGHEKHRDWASSQLA ATCNVEPSLFIDWFSGHLNFQIEHHLFPTMPRHNYRRVAPLVKALCAKHGLSYEVKPFLT ALVDIIRSLKKSGNVWLEAYLHQ
Uniprot No.

Target Background

Function
Mammals possess a diverse range of sphingoid bases, differing in their chain length and/or saturation and hydroxylation patterns. The predominant sphingoid base in mammalian ceramides is sphing-4-enine (sphingosine or SPH), characterized by a trans desaturation at carbon 4. FADS3, a ceramide desaturase, introduces a cis double bond between carbons 14 and 15 of SPH-containing ceramides, resulting in the formation of sphinga-4,14-dienine-containing ceramides (SPD ceramides). SPD ceramides are widely distributed in mammalian tissues and cells. Their unique structure, featuring a cis double bond, suggests a potential negative role in lipid microdomain formation compared to conventional ceramides. FADS3 also functions as a methyl-end fatty acyl coenzyme A (CoA) desaturase, introducing a cis double bond between the existing double bond and the terminal methyl group of the fatty acyl chain. It desaturates (11E)-octadecenoate (trans-vaccenoate, the primary trans fatty acid in cow milk) at carbon 13, producing (11E,13Z)-octadecadienoate (also known as conjugated linoleic acid 11E,13Z-CLA), likely participating in the biohydrogenation pathway of linoleic acid (LA).
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the confirmed enzymatic function of FADS3?

FADS3 acts as a methyl-end fatty acyl coenzyme A (CoA) desaturase that introduces a cis double bond between a preexisting double bond and the terminal methyl group of the fatty acyl chain. Specifically, it desaturates (11E)-octadecenoate (trans-vaccenoate) at carbon 13 to generate (11E,13Z)-octadecadienoate . This activity confirms FADS3 as a Δ13-desaturase, participating in the biohydrogenation pathway of linoleic acid (LA) . This function was elusive for nearly a decade after the gene's identification in 2000, until researchers demonstrated its capability to catalyze the Δ13-desaturation of trans-vaccenic acid, producing the trans11,cis13-conjugated linoleic acid isomer .

How does FADS3 differ from other FADS family members in tissue distribution?

Unlike FADS1 and FADS2, which are highly expressed in the liver, FADS3 displays a distinct tissue distribution pattern. Gene expression studies have revealed that FADS3 is transcribed in many tissues but shows relatively weak expression in the liver compared to other organs such as the lung and spleen . This differential expression pattern suggests specialized physiological roles for FADS3 that diverge from the primarily hepatic functions of FADS1 and FADS2. When designing experiments targeting tissue-specific functions of FADS3, researchers should consider these expression patterns to optimize sample collection and experimental design.

What is the relationship between FADS3 and lipid homeostasis?

Polymorphism analysis has highlighted the potential involvement of FADS3 in lipid homeostasis, particularly in modulating cholesterol and triglyceride plasma levels . The connection between FADS3 activity and lipid profiles suggests that this enzyme could play a role in metabolic disorders. When studying recombinant bovine FADS3, researchers should consider measuring comprehensive lipid profiles before and after experimental manipulation of FADS3 activity to capture these effects. The specific mechanisms through which FADS3 influences lipid parameters remain to be fully elucidated and represent an important area for future research.

What are the optimal conditions for expressing and purifying recombinant bovine FADS3?

For successful expression of recombinant bovine FADS3, researchers should consider using eukaryotic expression systems such as insect cells (Sf9, High Five) or mammalian cells (HEK293, CHO) rather than bacterial systems, as FADS3 contains transmembrane domains and requires proper folding. The protein should be tagged (His, FLAG, or GST) at the N-terminus to avoid interfering with the C-terminal region that may be important for enzymatic activity. Purification should be performed under mild conditions using detergents like DDM (n-Dodecyl β-D-maltoside) or CHAPS at concentrations just above their critical micelle concentration to maintain enzyme activity. During purification and storage, it's crucial to include reducing agents like DTT or β-mercaptoethanol to protect the essential cysteine residues in the active site. Enzyme assays should be conducted with appropriate lipid substrates, particularly trans-vaccenic acid, to confirm the Δ13-desaturase activity .

How can researchers accurately measure FADS3 enzymatic activity in experimental systems?

Measuring FADS3 enzymatic activity requires specialized techniques due to its membrane-bound nature and specific substrate requirements. Researchers should employ gas chromatography-mass spectrometry (GC-MS) to detect the conversion of trans-vaccenic acid to trans11,cis13-conjugated linoleic acid . Alternatively, liquid chromatography with tandem mass spectrometry (LC-MS/MS) can provide more sensitive detection of reaction products. When conducting in vitro assays, researchers should include appropriate cofactors such as NADH, NADPH, ferredoxin, and cytochrome b5, as these electron donors are essential for desaturase activity. Cell-based assays can employ stable isotope-labeled fatty acid substrates to track conversion rates. For accurate quantification, commercial ELISA kits are available that can measure FADS3 protein levels in bovine samples , but these should be complemented with activity assays to correlate protein levels with enzymatic function.

What approaches are recommended for investigating the role of FADS3 in polyunsaturated fatty acid metabolism?

To investigate FADS3's role in PUFA metabolism, researchers should employ both gain-of-function and loss-of-function approaches. CRISPR-Cas9 gene editing to generate FADS3 knockout models can reveal phenotypic changes in PUFA profiles. Studies have shown that FADS3 may influence docosahexaenoic acid (DHA) levels in liver and brain tissues , suggesting its involvement in omega-3 fatty acid metabolism. Stable isotope tracing experiments using 13C-labeled fatty acid precursors can map the specific metabolic pathways affected by FADS3 activity. Lipidomic analysis using high-resolution mass spectrometry should be employed to comprehensively profile changes in fatty acid composition, with particular attention to ratios between substrate and product fatty acids, such as the ratio of 22:5n-3 (DPA) to DHA, which has been reported to be higher in FADS3 knockout liver samples compared to wild-type .

How should researchers address the challenge of FADS3 substrate specificity in experimental designs?

FADS3 displays unique substrate specificity compared to other desaturases, primarily acting on trans-vaccenic acid . When designing experiments, researchers should include both conventional fatty acid substrates (similar to those used for FADS1 and FADS2) and trans-vaccenic acid to comprehensively evaluate FADS3 activity. If no activity is detected with standard substrates, this does not necessarily indicate inactive enzyme but may reflect the narrow substrate specificity of FADS3. Consider using microsomal preparations rather than purified enzyme for activity assays, as the native membrane environment may be crucial for proper enzyme function. Additionally, substrate competition assays can provide insights into substrate preference hierarchies. If working with recombinant systems, ensure that the expression host can produce the necessary cofactors and provide an appropriate membrane environment for proper enzyme folding and activity.

What controls are essential when evaluating FADS3 knockout or overexpression models?

When working with FADS3 genetic models, several controls are essential. For knockout studies, researchers should include both wild-type controls and heterozygous animals to assess gene dosage effects. Importantly, since FADS3 is located in close genomic proximity to FADS1 and FADS2 , researchers must confirm that manipulation of FADS3 does not inadvertently affect the expression of these related genes. qRT-PCR and Western blotting should be used to quantify mRNA and protein levels of all three FADS genes. For functional validation, measuring the ratio of substrate to product fatty acids (such as DPA to DHA) can serve as a biomarker of FADS3 activity . In overexpression models, include empty vector controls and monitor for potential toxicity effects from excessive membrane protein expression. When interpreting results, consider that compensatory mechanisms involving other desaturases may mask the full impact of FADS3 manipulation.

What are the potential pitfalls in translating in vitro FADS3 findings to in vivo systems?

Translating in vitro findings about FADS3 to in vivo systems presents several challenges. The controlled environment of in vitro studies may not reflect the complex regulation of FADS3, which has been shown to be a target gene for several transcription factors including NF-κB, MYCN, and p63 . In vivo, tissue-specific differences in FADS3 expression may lead to varied effects across organs, with particular attention needed for lung, spleen, and brain tissues where FADS3 expression differs from liver . Researchers should employ tissue-specific conditional knockout models rather than global knockouts to address these variations. Additionally, species differences in FADS3 function may limit the direct translation of findings across model organisms. When designing in vivo experiments, consider using stable isotope-labeled fatty acids administered to living animals to trace metabolic pathways under physiological conditions. Finally, the long-term effects of FADS3 manipulation on lipid homeostasis may differ from acute responses observed in vitro, necessitating longitudinal studies.

How is FADS3 implicated in disease pathogenesis and potential therapeutic applications?

Recent research has identified FADS3 as a potential biomarker and therapeutic target in certain diseases. Overexpression of FADS3 has been associated with poor prognosis in head and neck squamous cell carcinoma (HNSCC), with elevated expression correlating with shorter survival times . This overexpression significantly correlates with N stage, histologic grade, lymphovascular invasion, and lymph node neck dissection, indicating that patients with high FADS3 levels may be more prone to metastatic disease and higher malignancy grade .

For researchers investigating FADS3 in disease contexts, gene expression analysis using tools like The Cancer Genome Atlas (TCGA) can reveal correlations with clinical parameters. Specifically, studies should employ Kaplan-Meier survival analysis, GSEA (Gene Set Enrichment Analysis), and evaluation of tumor-infiltrating immune cells to comprehensively characterize the role of FADS3 in cancer progression . Beyond oncology, FADS3's involvement in lipid homeostasis suggests potential roles in metabolic disorders, cardiovascular diseases, and neurodegenerative conditions that warrant further investigation.

What genomic and transcriptomic approaches are most informative for studying FADS3 regulatory mechanisms?

To elucidate FADS3 regulatory mechanisms, researchers should employ a combination of genomic and transcriptomic approaches. ChIP-seq can identify transcription factor binding sites in the FADS3 promoter region, focusing particularly on NF-κB, MYCN, and p63, which have been identified as regulators of FADS3 . RNA-seq analysis across different tissues and physiological conditions can reveal tissue-specific expression patterns and responses to metabolic challenges. Additionally, alternative splicing appears to be an important regulatory mechanism for FADS3, distinct from patterns observed for FADS1 and FADS2 , suggesting that exon-specific RNA analysis should be included in transcriptomic studies.

For genetic association studies, researchers should analyze polymorphisms in the FADS gene cluster, as these have been linked to variations in lipid profiles . When designing such studies, it's essential to consider the close genomic proximity of the three FADS genes and potential linkage disequilibrium between polymorphisms. Functional validation of identified variants should include luciferase reporter assays for promoter variants and in vitro enzyme activity assays for coding region variants.

How might comparative analysis of FADS3 across species inform understanding of its evolutionary significance?

Functional studies should compare the substrate specificity of FADS3 orthologs from different species, as variations may reflect adaptation to different dietary fatty acid profiles. Additionally, analyzing the genomic organization of the FADS cluster across species can reveal evolutionary constraints and selection pressures. For bovine-specific studies, researchers should consider how domestication and selective breeding may have influenced FADS3 function, particularly in the context of dairy production where milk fat composition is economically important. Comparative expression studies should examine tissue distribution patterns across species to identify conserved and divergent regulatory mechanisms.

What are the recommended methods for quantifying FADS3 expression and activity in bovine tissues?

For accurate quantification of bovine FADS3, researchers should employ a multi-modal approach. At the mRNA level, quantitative RT-PCR using carefully designed primers that distinguish FADS3 from other FADS family members is essential. For protein quantification, commercially available ELISA kits specific for bovine FADS3 provide reliable and reproducible results . These kits can be used with serum, plasma, tissue homogenates, and cell culture supernatants . For activity measurements, gas chromatography with flame ionization detection (GC-FID) or GC-MS can quantify the conversion of trans-vaccenic acid to trans11,cis13-conjugated linoleic acid.

When working with tissue samples, researchers should note the differential expression of FADS3 across tissues, with lower expression in liver compared to lung and spleen . This necessitates tissue-specific optimization of extraction protocols and potentially higher input amounts for liver samples. For immunohistochemistry, the Human Protein Atlas approach can be adapted for bovine tissues to visualize FADS3 distribution at the cellular level . When analyzing results, researchers should normalize FADS3 expression to appropriate reference genes that show stable expression across the experimental conditions being tested.

What experimental design considerations are important when investigating FADS3 genetic variants?

When studying FADS3 genetic variants, researchers should employ a comprehensive approach that addresses both genetic and functional aspects. Initial identification of variants can be performed through targeted sequencing of the FADS3 gene or analysis of existing genomic databases. For bovine studies, breed differences should be considered, as dairy and beef cattle may exhibit different allele frequencies reflecting selection for different production traits.

For functional characterization, site-directed mutagenesis to introduce specific variants into expression constructs allows direct assessment of their impact on enzyme activity. Cell-based assays using stable transfection of FADS3 variants followed by fatty acid profiling can reveal functional consequences. When conducting association studies, researchers should carefully control for population stratification and consider environmental factors, particularly diet, which can influence FADS3 expression and activity. Given the potential role of FADS3 in lipid homeostasis , phenotyping should include comprehensive lipid profiles, including both conventional parameters (cholesterol, triglycerides) and detailed fatty acid composition analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.