Recombinant Bovine Fatty acid desaturase 6 (FADS6)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Genetic Features

The bovine FADS6 gene spans approximately 10,890 bp in intron 2 and encodes a 342-amino acid protein (ENSBTAP00000022906) involved in fatty acid desaturation . Key structural motifs include conserved histidine-rich domains (e.g., HX3_3H and HX2_2HH), which are essential for catalytic activity . Genetic variants in FADS6, such as g.57770744A > G and g.57772511C > T, significantly influence fatty acid composition (FAC) in Hanwoo cattle, including Vaccenic (C18:1n7) and Palmitoleic (C16:1n7) acids .

Table 1: Key FADS6 Genetic Variants and Associated Fatty Acids in Hanwoo Cattle

SNP IDAssociated Fatty AcidsEffect on FAC
g.57770744A > GVaccenic (C18:1n7), Stearic (C18:0)Dominant effect on lipid profiles
g.57772511C > TPalmitoleic (C16:1n7)Additive effect on desaturation

Functional Role in Fatty Acid Metabolism

FADS6 catalyzes the introduction of double bonds into fatty acid chains, facilitating the conversion of substrates like linoleic acid (C18:2n6) and α-linolenic acid (C18:3n3) into LC-PUFAs . Though direct assays on bovine FADS6 are unavailable, heterologous expression studies in yeast (Saccharomyces cerevisiae) for homologous FADS6 enzymes reveal:

  • Δ4 desaturation activity for docosahexaenoic acid (C22:6n3) synthesis .

  • Regulatory interplay with transcription factors like PPARαb, which binds to the FADS6 promoter to enhance expression .

Regulatory Mechanisms

PPARαb, a nuclear receptor, transcriptionally regulates FADS6 expression. Experimental evidence from fish models shows:

  • PPARαb agonists (e.g., WY-14643) upregulate FADS6 mRNA levels by 2.5-fold .

  • siRNA knockdown of PPARαb reduces FADS6 expression by 60–70% .
    These mechanisms suggest conserved regulatory pathways applicable to bovine systems.

Applications in Research and Agriculture

  1. Genetic Marker Development: FADS6 SNPs are linked to marbling scores and backfat thickness in cattle, enabling selective breeding for improved meat quality .

  2. Metabolic Engineering: Recombinant FADS6 could optimize LC-PUFA production in bioengineered systems, leveraging its desaturation activity .

  3. Nutritional Studies: Modulating FADS6 expression may alter the n-6/n-3 PUFA ratio, impacting inflammatory and metabolic health .

Challenges and Future Directions

  • Functional Characterization: Heterologous expression systems (e.g., yeast or mammalian cells) are needed to confirm bovine FADS6’s substrate specificity and kinetics.

  • Gene-Environment Interactions: Environmental factors (e.g., diet) may modulate FADS6 effects on FAC, requiring integrated omics approaches .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
FADS6; Fatty acid desaturase 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
FADS6
Target Protein Sequence
MEPAGGAPRESARAEALLGELEARVQEVVRASSWWERHGVDCAILALSLLALPPGFLCLR SDSPLVFALGITILGVCHYTLTVKGSHLATHGALTESRGWSKVWTLFFVEVCTSFTAEYA KYGHVKMHHGYTNVLGLGDSSTWRLPCLNRYVYMFLAPLLIPIITPLVAVERLREVELRT ALRTLGLISLGLYSQYWLLLNVSGFQSPSSALACMLITRSLLAHPYLHVNIFQHIGLPMF SPDKKPRRIHMMSLGVLNLPRLPVLDWAFGHSLISCHVEHHLFPRLSDNMCLKVKPVVSQ FLHEKQLPYNEDSYLARFWLFLQRYEEFMVQTPPITELVGLQ
Uniprot No.

Target Background

Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the bovine FADS gene cluster and where is FADS6 positioned within it?

The bovine fatty acid desaturase (FADS) gene cluster consists of FADS1, FADS2, FADS3, and FADS6, which collectively function as key enzymatic components in fatty acid metabolism. These genes encode enzymes that catalyze critical desaturation steps in the biosynthesis of polyunsaturated fatty acids. FADS6 is positioned on bovine chromosome 19 (UCSC chr19:57766830-57782480) and represents one of the four major desaturases in the cluster. Each member of this gene family has distinct but related functions in the metabolism of fatty acids, with FADS6 playing specific roles in the desaturation process that affects fatty acid composition in bovine tissues .

How does FADS6 differ functionally from other desaturases in the FADS gene cluster?

While all members of the FADS gene cluster participate in fatty acid desaturation, FADS6 has specific substrate preferences and catalytic properties that distinguish it from FADS1, FADS2, and FADS3. Unlike FADS2, which is known to synthesize Delta-6-desaturase (D6D) that catalyzes the initial step in highly unsaturated fatty acid (HUFA) synthesis, FADS6 appears to have distinct roles in the modulation of specific fatty acids including palmitoleic acid (C16:1n7) and stearic acid (C18:0). Genetic studies reveal that FADS6 variants significantly affect these fatty acid compositions in bovine tissues, suggesting a specialized role in the desaturation pathway distinct from other FADS enzymes .

What is the homology relationship between bovine FADS6 and human desaturases?

Research has established that bovine FADS2 is homologous to human FADS6, indicating evolutionary conservation of this enzymatic function across species. This homology suggests similar catalytic mechanisms and potentially comparable roles in fatty acid metabolism between bovine and human systems. The cross-species conservation of FADS6 structure and function underscores its biological importance in mammalian fatty acid metabolism and provides a basis for using bovine models to understand aspects of human fatty acid desaturation processes .

How do genetic variants in the FADS6 gene affect fatty acid composition in bovine tissues?

Genetic analysis of FADS6 in Hanwoo cattle has identified six significant genetic variations: three located in the second intron (g.3391G>A, g.3660A>C, and g.4655) and three in the sixth exon (g.15527, g.15590, and g.15657C>T). Statistical analysis has revealed that variants g.3391G>A and g.15657C>T show significant association with palmitoleic acid composition, a monounsaturated fatty acid known to influence hepatic lipid accumulation and insulin resistance. Most notably, the SNP g.3660A>C demonstrates strong associations with both palmitoleic acid and stearic acid composition, exhibiting significant additive and dominance effects for palmitoleic acid (P>0.07, P>0.006) and strong additive effects for stearic acid (P>0.004). These genetic influences are particularly important as stearic acid affects carcass fat firmness and lipid melting points in beef, directly impacting meat quality characteristics .

What role does FADS6 play in NAD+/NADH redox balance and how does this impact cellular metabolism?

While specific research on FADS6's role in redox balance is limited, studies on related desaturases (particularly D5D and D6D) demonstrate their importance in glycolytic NAD+ recycling. Desaturases can regenerate NAD+ from NADH during fatty acid desaturation, providing an alternative pathway for NAD+ recycling that supports ongoing glycolysis when aerobic respiration is impaired. This mechanism creates a bidirectional link between glycolysis and polyunsaturated fatty acid desaturation. By extension, FADS6 likely contributes to cellular redox homeostasis, particularly under conditions of metabolic stress or impaired mitochondrial function, though specific studies confirming this function in FADS6 are needed .

How does the interaction between FADS6 expression and environmental factors affect fatty acid profiles in bovine systems?

The interaction between FADS6 genetic variants and environmental factors (particularly dietary components) creates complex phenotypic outcomes in fatty acid profiles. While genetic variations establish baseline enzymatic properties, environmental conditions can significantly modulate FADS6 expression and activity. Nutritional factors, particularly dietary fatty acid composition and intake levels, can influence FADS6 activity through substrate availability and potential feedback regulation mechanisms. Research indicates that the n-6:n-3 fatty acid ratios in the diet may interact with FADS6 genotypes to produce varying fatty acid compositions in bovine tissues. This gene-environment interaction must be considered when designing experimental systems to study FADS6 function or when interpreting fatty acid profile data in bovine models .

What are the recommended protocols for cloning and expressing recombinant bovine FADS6?

The optimal protocol for cloning and expressing recombinant bovine FADS6 involves:

  • Gene Isolation: Extract total RNA from bovine tissue samples (preferably liver or adipose tissue) where FADS6 is highly expressed, followed by RT-PCR amplification of the complete FADS6 coding sequence using gene-specific primers designed from the reference sequence (UCSC chr19:57766830-57782480).

  • Vector Construction: Clone the amplified FADS6 cDNA into an appropriate expression vector containing:

    • A strong promoter (CMV for mammalian expression; T7 for bacterial systems)

    • An affinity tag (His6 or GST) for purification

    • Appropriate selection markers

  • Expression System Selection: Choose between:

    • Mammalian cells (HEK293 or CHO cells) for proper post-translational modifications

    • Insect cells (Sf9 or High Five) using baculovirus expression systems

    • Yeast systems (Pichia pastoris) which can provide proper folding while being more economical

  • Purification Strategy: Implement a two-step purification:

    • Initial affinity chromatography using the fusion tag

    • Secondary size-exclusion or ion-exchange chromatography for higher purity

This approach ensures production of functional recombinant FADS6 suitable for enzymatic assays and structural studies .

What assays are most effective for measuring recombinant bovine FADS6 activity?

For optimal assessment of recombinant bovine FADS6 enzymatic activity, the following assays are recommended:

  • Substrate Conversion Assay:

    • Incubate purified FADS6 with labeled fatty acid substrates

    • Analyze conversion products using gas chromatography (GC) with a fused silica capillary column (similar to omega wax 205, 30m × 0.32mm i.d., 0.25μm film thickness)

    • Maintain injection port at 250°C and detector at 300°C

    • Quantify results as percentage of fatty acids based on total peak area

  • Radiometric Assay:

    • Use 14C-labeled fatty acid substrates

    • Extract and analyze desaturated products by thin-layer chromatography

    • Quantify radioactivity in product bands to determine conversion efficiency

  • Coupled Enzymatic Assay:

    • Monitor NAD+/NADH conversion spectrophotometrically during desaturation

    • Calculate enzymatic activity based on changes in absorbance at 340nm

Each method offers distinct advantages, with the GC-based substrate conversion assay providing the most comprehensive profile of FADS6 activity across multiple potential substrates .

How should researchers design experiments to investigate the influence of FADS6 variants on fatty acid metabolism?

To effectively study FADS6 variants and their metabolic effects, researchers should implement a multi-level experimental design:

  • Genetic Analysis Phase:

    • Screen for FADS6 variants using DNA sequencing across the entire gene region

    • Confirm variants through RFLP (Restriction Fragment Length Polymorphism) and AS-PCR (Allele Specific PCR)

    • Analyze genotype frequencies and Hardy-Weinberg Equilibrium using statistical software (e.g., Arlequin)

  • Functional Characterization Phase:

    • Express recombinant wild-type and variant FADS6 proteins

    • Compare enzymatic activities using substrate conversion assays

    • Analyze kinetic parameters (Km, Vmax) for each variant

  • In Vivo Correlation Studies:

    • Genotype study animals for identified FADS6 variants

    • Measure fatty acid compositions in relevant tissues using gas chromatography

    • Apply statistical models that include fixed effects for genotype, covariates for age, and random effects for sire

  • Data Analysis Strategy:

    • Use GLM procedures (as in SAS) for association testing

    • Apply multiple testing corrections

    • Evaluate both additive and dominance effects of variants

This comprehensive approach allows for robust assessment of how FADS6 genetic variation influences fatty acid metabolism at both molecular and physiological levels .

What statistical approaches are most appropriate for analyzing associations between FADS6 SNPs and fatty acid profiles?

For robust statistical analysis of associations between FADS6 single nucleotide polymorphisms (SNPs) and fatty acid profiles, researchers should implement:

  • Preparatory Analysis:

    • Test fatty acid measurements for normal distribution

    • Calculate genotyping frequencies, minor allele frequencies, and Hardy-Weinberg Equilibrium (HWE) using specialized software such as Arlequin

    • Select appropriate fatty acids for association testing based on detectability and relevance to the FADS6 pathway

  • Primary Association Testing:

    • Apply General Linear Model (GLM) procedures that include:

      • Fixed effect for genotype

      • Covariate for age

      • Random effect for sire to account for genetic background

    • Use software packages such as SAS 9.2 for statistical analysis

  • Advanced Statistical Approaches:

    • Implement haplotype analysis for multiple SNPs

    • Apply mixed models to account for population structure

    • Conduct pathway analysis to understand broader metabolic impacts

This statistical framework, as applied in studies of FADS6 variants in Hanwoo cattle, provides a comprehensive assessment of genotype-phenotype relationships while controlling for confounding factors .

How do you distinguish functional FADS6 variants from neutral polymorphisms in genetic association studies?

Distinguishing functional FADS6 variants from neutral polymorphisms requires a multi-faceted approach:

  • Statistical Evidence:

    • Identify variants with statistically significant associations to fatty acid profiles after correction for multiple testing

    • Prioritize variants showing consistent associations across different fatty acids or related metabolic traits

    • Evaluate additive and dominance effects to understand genetic mechanisms

  • Functional Prediction:

    • Analyze variant location within gene structure (exonic variants, particularly non-synonymous changes, have higher probability of functional impact)

    • Apply bioinformatic tools to predict functional consequences:

      • For coding variants: assess amino acid conservation, predicted protein structure changes

      • For non-coding variants: evaluate potential effects on splicing, transcription factor binding, or regulatory elements

  • Experimental Validation:

    • Perform in vitro enzymatic assays comparing wild-type and variant FADS6

    • Conduct site-directed mutagenesis to confirm the specific effect of individual variants

    • Use reporter gene assays for putative regulatory variants

Research on FADS6 has identified potentially functional variants such as g.3660A>C, which shows strong association with both palmitoleic acid (C16:1n7) and stearic acid (C18:0) composition, with demonstrable additive and dominance effects .

What is the relationship between FADS6 intronic variants and fatty acid metabolism?

The relationship between FADS6 intronic variants and fatty acid metabolism reveals complex regulatory mechanisms:

  • Observed Associations:

    • Intronic variants in FADS6, particularly those in intron 2 (g.3391G>A, g.3660A>C, and g.4655), show significant associations with fatty acid composition

    • Specifically, g.3391G>A and g.3660A>C demonstrate associations with palmitoleic acid (C16:1n7) levels

    • g.3660A>C additionally shows strong association with stearic acid (C18:0) composition

  • Potential Mechanisms:

    • These intronic variants may:

      • Affect splicing efficiency or alternative splicing patterns

      • Influence transcription factor binding or chromatin structure

      • Contain intronic enhancers or silencers that modulate FADS6 expression

      • Impact mRNA stability or processing

  • Functional Implications:

    • Despite being non-coding, these intronic variants demonstrate significant additive and dominance effects on fatty acid profiles

    • The variant g.3660A>C shows particularly strong dominance effects for palmitoleic acid and additive effects for stearic acid

    • These effects suggest that intronic variants substantively influence FADS6 function, potentially through modulation of expression levels or splicing patterns

This evidence indicates that intronic FADS6 variants play important regulatory roles in fatty acid metabolism and should not be dismissed as neutral or non-functional polymorphisms .

How does recombinant bovine FADS6 function compare with its human ortholog?

A comparative analysis of recombinant bovine FADS6 and its human ortholog reveals important similarities and differences:

  • Evolutionary Relationship:

    • Research has established that bovine FADS2 is homologous to human FADS6, indicating evolutionary conservation of this enzymatic pathway

    • This homology suggests shared ancestral origin and potentially similar core functions in fatty acid metabolism

  • Catalytic Functions:

    • Both enzymes participate in polyunsaturated fatty acid (PUFA) desaturation pathways

    • The human ortholog contributes to the synthesis of highly unsaturated fatty acids (HUFAs)

    • Both enzymes likely participate in the NAD+/NADH redox balance, though specific activity levels may differ between species

  • Structural Comparisons:

    • Protein sequence alignment shows conserved catalytic domains and desaturase motifs

    • Species-specific variations in regulatory regions may account for differences in expression patterns and regulation

    • Differences in post-translational modifications may affect enzyme stability and activity

  • Substrate Preferences:

    • While both enzymes function in fatty acid desaturation, subtle differences in substrate specificity and conversion efficiency likely exist

    • These differences may reflect adaptations to species-specific dietary patterns and metabolic requirements

This comparative understanding provides valuable insights for translational research and for using bovine models to understand aspects of human fatty acid metabolism .

What is the role of FADS6 in modulating the ratio of saturated to unsaturated fatty acids in bovine tissues?

FADS6 plays a critical role in determining the balance between saturated and unsaturated fatty acids in bovine tissues through several mechanisms:

The ability to modulate the MUFA/SFA ratio through FADS6 has significant implications for producing beef with more favorable fatty acid profiles for human consumption .

Table 1: Comparative Analysis of Major FADS6 Genetic Variants and Their Effects on Fatty Acid Composition

Genetic VariantLocationAssociated Fatty AcidsStatistical SignificanceEffect TypePotential Mechanism
g.3391G>AIntron 2Palmitoleic acid (C16:1n7)SignificantAdditive & DominancePossible regulatory effect on gene expression
g.3660A>CIntron 2Palmitoleic acid (C16:1n7), Stearic acid (C18:0)Highly significant (P>0.004 for stearic acid)Strong additive & dominanceRegulatory effect on gene expression or splicing efficiency
g.4655Intron 2Not significantly associated--Likely neutral polymorphism
g.15527Exon 6Not significantly associated--Potential structural effect depending on amino acid change
g.15590Exon 6Not significantly associated--Potential structural effect depending on amino acid change
g.15657C>TExon 6Palmitoleic acid (C16:1n7)SignificantDominanceDirect effect on protein structure/function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.