Recombinant Bovine Ferric-chelate reductase 1 (FRRS1)

Shipped with Ice Packs
In Stock

Description

Biochemical Functions

FRRS1 operates as a ferric-chelate reductase, primarily reducing Fe³⁺ to Fe²⁺ for cellular uptake . Key roles include:

  • Iron Homeostasis: Facilitates endosomal iron transport by converting transferrin-bound Fe³⁺ to Fe²⁺, which is then exported to the cytoplasm via divalent metal transporter 1 (DMT1) .

  • Antioxidant Role: Regulates reactive oxygen species (ROS) by maintaining ascorbic acid levels, which scavenge free radicals .

  • Pathological Implications: Modulates ferroptosis—a iron-dependent cell death pathway—by influencing glutathione peroxidase 4 (GPX4) and lipid peroxidation .

Role in Disease Mechanisms

  • Ferroptosis Inhibition: Overexpression of FRRS1 in intestinal ischemia models reduced iron accumulation, ROS production, and inflammatory responses. It upregulated GPX4 (an antioxidant enzyme) while suppressing ACSL4 (a pro-ferroptotic protein) .

  • Cancer Associations:

    • Upregulated in cervical squamous cell carcinoma (SiHa/HeLa cells), where knockdown inhibited tumor growth and induced apoptosis .

    • Elevated in glioma, correlating with poor prognosis and aggressive tumor behavior .

  • Neurodegenerative Disease: Predicted to be a risk gene for Alzheimer’s disease due to upregulated expression in affected brain tissue .

Mechanistic Insights

FRRS1 interacts with the Hippo signaling pathway (LATS1/YAP/TAZ axis), which regulates cell proliferation and death. Its overexpression inhibits Hippo signaling, suggesting a protective role against tissue damage .

Applications in Biomedical Research

  • Therapeutic Target: Potential for treating iron dysregulation disorders (e.g., anemia, neurodegenerative diseases) and cancers reliant on iron metabolism .

  • Tool for Ferroptosis Studies: Used to investigate iron-dependent cell death pathways and screen inhibitors .

  • Drug Interaction Studies: Sensitivity to environmental toxins (e.g., aflatoxin B1, sodium arsenite) has been documented, highlighting its role in toxicology .

Comparative Analysis with Orthologs

SpeciesProteinKey Difference
HumanFRRS189% sequence homology; similar iron reductase activity
MouseFrrs1Used in knockout models for iron metabolism studies
ZebrafishFrrs1Studied in developmental iron transport mechanisms

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we understand that specific requirements may arise. If you have a preference for a particular format, please indicate your needs when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are routinely shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
FRRS1; Ferric-chelate reductase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-591
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
FRRS1
Target Protein Sequence
MTAPGFTVSAFILLLHVSFVANYPSGKVTKSCGGMIPEHGHTPQSHPAHNISVSQKTFRP GDQIKVTLSGPPFKGFLLEARDAENLSGPPVGSFTLIDSHVSQLLTCEDVQGSAVSHRSP SKKTEIKVFWDAPSGAPNHITFLATVVEKYKIYWVKIPGPVISQPNVPPFTTPEATIAPM PTVPSVSHLTRSFNASDCGNKKFCIRSPLNCDPEKERACVLLSFTRDDQSVMVEMSGPSK GYLSVAFSHDRWMGDDDAYVCILEDQIVHIQPSHLTGRSHPIMDFGDPLEDMAWRLVDGV MQCSFRRNITLPGVKNRFDLNASYYIFVADGAAVDGRIHKHSQQPLITYEKYNVTGDPKN IGGSHSLLLLKVHGALMFVAWMTTVSVGVLIARFFKPVWSKALFGDAAWFQVHRTLMLTT SALTFIAFLLPFIYRGGWNWHAGYHPYLGFIVMVLAVLQLLLAAFRPPLHDPRRQMFNWT HWSMGTAARIIAVAAMFLGMDLPGLNLPGPWKTYAMIGFVAWHVGTEIILEIHAYRLSRK VEILDDDRIQILQSFTAAEAEGYVFKKVVLAIYVCGNLTFLTMFLSAINRL
Uniprot No.

Target Background

Function
Ferric-chelate reductases play a critical role in reducing Fe(3+) to Fe(2+) before its transport from the endosome to the cytoplasm.
Database Links
Protein Families
FRRS1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Bovine FRRS1 and how does it relate to FRRS1L?

Recombinant Bovine FRRS1 (Ferric-Chelate Reductase 1) is a protein involved in iron metabolism. While FRRS1L (Ferric Chelate Reductase 1 Like protein) has been extensively studied in neuronal contexts, showing associations with AMPA receptors (AMPARs) in the brain, FRRS1 represents the primary functional form. Both proteins share structural similarities but may have evolved distinct functions across different species and tissues. FRRS1L has been shown to interact with both GluA1 and GluA2 subunits of AMPARs in heterologous cells and mouse neurons, suggesting potential roles in receptor trafficking and function .

What expression systems are optimal for producing recombinant FRRS1?

Based on experimental approaches with related proteins, human embryonic kidney 293T (HEK) cells have been successfully used for expression of FRRS1L constructs. For recombinant bovine FRRS1, similar mammalian expression systems would likely be appropriate. The methodology typically involves transfection with expression vectors containing the protein of interest using reagents such as effectene transfection reagent. For optimal results, expression should be verified 48 hours post-transfection through Western blotting with appropriate antibodies .

How can I detect recombinant FRRS1 in experimental systems?

Detection methods for FRRS1 proteins typically involve epitope tagging strategies or specific antibodies. Common approaches include:

  • N-terminal tagging after the signal peptide sequence (e.g., HA tag)

  • C-terminal tagging (e.g., Myc tag)

  • Immunoblotting with specific antibodies

For immunoblotting, samples are typically resolved by SDS-PAGE using 10% precast gels and then subjected to detection with appropriate antibodies. For tagged constructs, commercially available anti-tag antibodies (anti-HA, anti-Flag, anti-Myc) at 1:1,000 dilution have proven effective in previous studies of FRRS1L .

How can protein-protein interactions of bovine FRRS1 be assessed experimentally?

Co-immunoprecipitation (Co-IP) assays provide a robust method for examining FRRS1 protein interactions. The methodology based on FRRS1L studies would include:

  • Co-transfection of tagged FRRS1 and potential interacting proteins in heterologous cells (HEK cells)

  • Cell lysis in buffer containing 25 mM Tris (pH 7.4), 1% Triton X-100, 150 mM NaCl, 5% glycerol, 1 mM EDTA, and EDTA-free protease inhibitors

  • Incubation of equal amounts of cell lysate with appropriate affinity beads (e.g., anti-Flag M2)

  • Washing steps (three times with 300 μl lysis buffer)

  • Elution and analysis by SDS-PAGE followed by immunoblotting

This approach has successfully demonstrated that FRRS1L interacts with both GluA1 and GluA2 subunits of AMPARs, suggesting similar techniques could be applied to identify bovine FRRS1 interaction partners .

What methods are effective for studying FRRS1 localization in tissue or cell preparations?

Subcellular localization studies of FRRS1 can be approached using fractionation techniques and immunofluorescence microscopy. Based on methodologies used for FRRS1L:

Subcellular Fractionation:

  • Tissue homogenization in non-detergent buffer (250 mM sucrose, 1 mM EDTA, 10 mM Tris-HCl buffer pH 7.2, protease inhibitors)

  • Brief sonication with two 10-s pulses

  • Centrifugation at 1,000 × g for 10 min to remove nuclei

  • Ultracentrifugation of the post-nuclear supernatant at 100,000 × g (2 hours, 4°C)

  • Membrane fraction isolation and analysis by Western blotting

Immunofluorescence:

  • Fixation of cells or tissue sections with appropriate fixatives

  • Permeabilization with 0.2% Triton X-100

  • Blocking with 5% normal goat serum

  • Primary antibody incubation at 4°C overnight

  • Secondary antibody labeling and confocal microscopy

In FRRS1L studies, researchers found that the protein partially co-localizes with GluA1 and primarily localizes at non-synaptic membranes, providing a methodological framework for similar investigations with bovine FRRS1 .

What gene editing approaches are suitable for studying FRRS1 function?

CRISPR/Cas9-mediated gene editing has been successfully applied to study FRRS1L function and could be adapted for bovine FRRS1 research. The methodology includes:

  • sgRNA design targeting specific exons of the FRRS1 gene

  • Cloning sgRNAs into appropriate vectors (e.g., pspCas9(bb)-2A-IRES-GFP)

  • Transfection of target cells with CRISPR constructs

  • Verification of knockout efficiency via Western blotting or sequencing

  • Functional assessment of knockout effects

For in vivo applications, studies have demonstrated embryonic electroporation techniques where FRRS1L sgRNA plasmids were injected into embryonic ventricles followed by voltage application to target neural progenitors .

What are the optimal conditions for maintaining FRRS1 stability in experimental preparations?

Based on protocols for related proteins, FRRS1 stability can be maintained through careful buffer formulation and handling:

  • Homogenization buffers should contain protease inhibitors (1 tablet/10 ml, EDTA-free)

  • Samples should be kept on ice throughout preparation

  • For immunoprecipitation, use lysis buffer containing 25 mM Tris (pH 7.4), 1% Triton X-100, 150 mM NaCl, 5% glycerol, 1 mM EDTA

  • Storage at -80°C in aliquots to minimize freeze-thaw cycles

  • Addition of reducing agents (e.g., β-mercaptoethanol) in loading buffers for SDS-PAGE

These conditions have been effective in maintaining protein integrity during biochemical analysis of FRRS1L and would likely be applicable to bovine FRRS1 .

How can I quantitatively analyze FRRS1 expression levels in different experimental conditions?

Quantitative analysis of FRRS1 expression can be performed using:

  • Western blotting with densitometry:

    • Equal protein loading determined by BCA protein assay

    • Normalization to housekeeping proteins (e.g., α-tubulin at 1:5000 dilution)

    • ImageJ software for densitometric analysis

  • Immunofluorescence quantification:

    • Maximal projection images from 4-6 serial optical sections

    • Background subtraction with consistent threshold values

    • Measurement of integrated fluorescence intensity

    • Region of interest (ROI) definition along relevant cellular structures

    • Calculation of average fluorescence intensity (total intensity divided by area)

These approaches allow for reliable quantitative comparison between experimental conditions, as demonstrated in FRRS1L studies .

What functional assays are appropriate for characterizing bovine FRRS1 activity?

While the search results don't specifically address bovine FRRS1 functional assays, approaches used for FRRS1L could be adapted:

  • Gain-of-function studies:

    • Overexpression in relevant cell types followed by functional readouts

    • Assessment of effects on interacting proteins or pathways

  • Loss-of-function studies:

    • Single-cell knockout approaches

    • Analysis of effects on partner protein expression and localization

In FRRS1L studies, researchers found that knockout significantly reduced GluA1 expression at the neuronal surface and decreased AMPAR-mediated synaptic transmission, while overexpression did not significantly change glutamatergic synaptic transmission .

How does phosphorylation status affect FRRS1 function and what methods can detect these modifications?

While specific information about FRRS1 phosphorylation is not provided in the search results, standard approaches for post-translational modification analysis could be applied:

  • Phospho-specific antibody development and validation

  • Mass spectrometry analysis of purified protein

  • Phosphatase treatment experiments to confirm modification

  • Site-directed mutagenesis of putative phosphorylation sites

  • Functional assessment of phospho-mimetic and phospho-dead mutants

These methodological approaches would help determine whether phosphorylation plays a regulatory role in bovine FRRS1 function, similar to studies conducted with other proteins in this family.

What experimental evidence supports the role of FRRS1 in cellular processes?

The table below summarizes key experimental findings related to FRRS1L that may guide investigations into bovine FRRS1:

Experimental ApproachKey Findings for FRRS1LPotential Relevance to Bovine FRRS1
Co-immunoprecipitationInteracts with GluA1 and GluA2 subunits of AMPARsSuggests potential role in protein complexes
Dimerization experimentsDoes not form dimers/oligomers in HEK cellsMay function as monomeric protein
Surface localizationPartially co-localizes with GluA1 at neuronal surfaceMay have specific subcellular distribution
Vesicle associationLocalizes to dynein vesicles but not kinesin5B vesiclesPotential role in specific transport mechanisms
CRISPR/Cas9 knockoutReduces GluA1 expression and decreases AMPAR-mediated synaptic transmissionCritical functional role in protein expression
Overexpression studiesDoes not change glutamatergic synaptic transmissionMay function within specific concentration ranges

Understanding these experimental findings can help guide hypothesis development and experimental design for bovine FRRS1 studies .

How do FRRS1 mutations affect protein function and what experimental approaches detect these effects?

While the search results don't provide specific information about bovine FRRS1 mutations, FRRS1L mutations in humans are associated with epilepsy, choreoathetosis, and cognitive deficits. Experimental approaches to study mutation effects could include:

  • Generation of mutant constructs through site-directed mutagenesis

  • Expression in heterologous systems and functional comparison to wild-type

  • Structural studies to determine mutation effects on protein folding or interaction surfaces

  • Rescue experiments in knockout systems to assess functional complementation

These approaches would help determine structure-function relationships and the impact of specific mutations on bovine FRRS1 activity .

What are the current limitations in FRRS1 research and how might they be addressed?

Current limitations in FRRS1 research include:

  • Species-specific differences in function and regulation

  • Limited availability of bovine-specific reagents and antibodies

  • Incomplete understanding of tissue-specific roles outside the nervous system

  • Challenges in determining precise enzymatic activities

These limitations could be addressed through:

  • Development of species-specific antibodies and research tools

  • Comparative studies across species to identify conserved and divergent functions

  • Application of advanced proteomics to identify comprehensive interaction networks

  • CRISPR/Cas9-mediated tagging of endogenous proteins to study physiological expression

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.