Recombinant Bovine Fetal and adult testis-expressed transcript protein homolog (FATE1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
FATE1; FATE; Fetal and adult testis-expressed transcript protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
FATE1
Target Protein Sequence
MAGGAVPNLKEKMQVPKDEDLLLGSFRDNQECSVAAEMKEHMSRLLGASQRRQRVDPKAV GSAVVWNTAANQSKKMGPQLRGVGVVGEQGDGGAQPQENPGGSQGMRSQFERRELNTLAE IGLEELNELEMEIMRRQLFMITERLRYLEDQSATWHQREVLLFTMLLSSCITNLWLWMRQ
Uniprot No.

Target Background

Function

Recombinant Bovine Fetal and adult testis-expressed transcript protein homolog (FATE1) is involved in regulating endoplasmic reticulum (ER)-mitochondria coupling. It negatively regulates ER-mitochondria distance and Ca2+ transfer from the ER to mitochondria, potentially impacting apoptosis regulation. FATE1 may also cooperate with RNF183 to control BIK protein levels, thereby modulating apoptotic signaling.

Database Links

KEGG: bta:281153

STRING: 9913.ENSBTAP00000008963

UniGene: Bt.5914

Subcellular Location
Mitochondrion. Mitochondrion outer membrane. Endoplasmic reticulum membrane; Single-pass membrane protein; Cytoplasmic side.

Q&A

What is the molecular structure and function of FATE1 protein?

Structure-function studies reveal that the C-terminal domain (amino acids 125-183) is sufficient for mitochondrial targeting, while the isolated N-terminal domain (amino acids 1-124) primarily localizes to the nucleus . Three stretches of basic residues in the C-terminal domain contribute to mitochondrial targeting, with mutations of these residues disrupting proper localization .

DomainAmino Acid PositionPrimary Function
N-terminal1-124Nuclear localization when isolated
Coiled-coil (CC1)~80-120Protein-protein interactions
Coiled-coil (CC2)~130-150Mitochondrial interactions
Transmembrane~160-180ER membrane insertion

Where is FATE1 physiologically expressed, and what is its normal function?

In normal tissues, FATE1 expression is predominantly restricted to testis and adrenal gland . The protein exhibits strong expression in spermatogonia, primary spermatocytes, and Sertoli cells within seminiferous tubules . This restricted expression pattern suggests specialized roles in reproductive and endocrine tissues.

FATE1 is believed to participate in early testicular differentiation and cell proliferation regulation . Its strategic localization at the interface between the endoplasmic reticulum (ER) and mitochondria suggests a role in regulating organelle communication and calcium homeostasis in these specific tissues .

How conserved is FATE1 across different mammalian species?

While the search results don't provide direct sequence comparisons between bovine and other mammalian FATE1 proteins, the conservation of function across species can be inferred. Both human and rhesus macaque FATE1 proteins exhibit similar subcellular localization patterns and functional properties . The availability of recombinant FATE1 proteins from multiple species (human and rhesus macaque) for research purposes suggests significant conservation of protein structure and function .

For researchers working with bovine FATE1, it's advisable to perform sequence alignment analyses to identify conserved domains before designing experiments targeting specific protein regions. The high conservation of the C-terminal domain across mammalian species makes it a reliable target for antibody development and functional studies.

What expression systems are optimal for producing functional recombinant bovine FATE1?

Based on successful expression of FATE1 from other species, two primary expression systems can be recommended for bovine FATE1:

  • Mammalian Expression (HEK293 cells): This system has been successfully used for rhesus macaque FATE1 with His(Fc)-Avi tag . Mammalian expression provides proper post-translational modifications and protein folding, which may be critical for functional studies. For transmembrane proteins like FATE1, mammalian expression often yields properly folded protein with native conformation.

  • In Vitro Cell-Free System: Successfully used for human FATE1 with GST-tag . This approach offers advantages in terms of speed and scalability, and may be suitable for applications where post-translational modifications are less critical.

For functional studies examining FATE1's role in ER-mitochondria communication, the mammalian expression system is recommended as it better preserves the protein's native conformation and membrane-association properties.

What purification strategies yield the highest purity for functional studies of bovine FATE1?

Effective purification of recombinant bovine FATE1 requires strategies that account for its membrane-association properties:

  • Affinity Chromatography: For GST-tagged FATE1, glutathione affinity chromatography with elution in buffer containing 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 has proven effective . For His-tagged versions, immobilized metal affinity chromatography (IMAC) is appropriate.

  • Detergent Selection: Given FATE1's transmembrane domain, mild detergents (0.1% Triton X-100 or 0.1% DDM) during extraction and purification help maintain protein solubility and native conformation.

  • Storage Conditions: Proper storage is critical - aliquoting and storing at -80°C in PBS buffer prevents repeated freeze-thaw cycles that can compromise protein integrity .

What methodologies can effectively detect and measure FATE1 localization and function?

Several complementary approaches can be employed to study bovine FATE1:

  • Subcellular Fractionation: A robust method to separate crude mitochondria, ER, pure mitochondria, and MAM (mitochondria-associated membranes) fractions, with subsequent immunoblotting to detect FATE1 distribution . This allows quantitative assessment of FATE1's distribution between cellular compartments.

  • Confocal Immunofluorescence Microscopy: Triple-labeling with FATE1 antibodies alongside ER markers (calreticulin) and mitochondrial markers (HSP60) can visualize FATE1 at ER-mitochondria contact sites . For quantitative analysis, measure the intensity of FATE1 staining in correspondence of ER–mitochondria contact sites compared to total mitochondrial surface.

  • Transmission Electron Microscopy (TEM): For ultrastructural analysis of ER-mitochondria contacts in cells expressing or depleted of FATE1 .

  • Calcium Flux Measurements: Using aequorin-based calcium probes to assess mitochondrial Ca²⁺ uptake following histamine or ATP stimulation can reveal FATE1's functional impact on organelle communication .

  • Split-GFP Reporter System: A specialized tool for quantifying ER-mitochondria contacts in living cells expressing or depleted of FATE1 .

How does FATE1 regulate ER-mitochondria communication and Ca²⁺ homeostasis?

FATE1 functions as a critical regulator of ER-mitochondria coupling and calcium signaling between these organelles. When expressed in cells, FATE1 decreases ER-mitochondria contacts, as measured by reduced overlap of ER and mitochondria fluorescent probes, decreased signal from split-GFP-based contact site reporters, and fewer ER-mitochondria contact sites visible by transmission electron microscopy .

This physical uncoupling has profound functional consequences for calcium signaling. FATE1 expression significantly decreases mitochondrial Ca²⁺ uptake following histamine or ATP stimulation, which normally triggers calcium release from ER stores . This reduction in calcium transfer appears to be a direct result of increased physical distance between the organelles rather than altered calcium channel function.

The molecular mechanism involves FATE1's strategic positioning at the ER-mitochondria interface, where it may act as a physical spacer that prevents close apposition of the organelles. This model is supported by the detection of FATE1 in MAM fractions and its enrichment at ER-mitochondria contact sites by immunofluorescence .

What is the mechanism by which FATE1 confers resistance to apoptosis?

FATE1 exhibits potent anti-apoptotic activity through several complementary mechanisms:

  • Disruption of Ca²⁺-dependent Apoptotic Signaling: By reducing ER-mitochondria calcium transfer, FATE1 impairs apoptotic calcium signaling pathways activated by oxidative stress (H₂O₂) and C2-ceramide . Experimental evidence shows FATE1 expression significantly decreases caspase-3/7 activity following these treatments.

  • Mitochondrial Network Stabilization: FATE1 promotes mitochondrial hyperfusion and protects against fragmentation induced by apoptotic stimuli like TNF and valinomycin . This maintenance of mitochondrial network integrity appears to involve mitofusin 2 (Mfn2) but not Mfn1 .

  • Pro-apoptotic Protein Degradation: FATE1 mediates the degradation of the pro-apoptotic BH3-only protein Bik, thereby removing a key facilitator of the intrinsic apoptotic pathway .

  • Chemoresistance Mechanism: FATE1 expression decreases sensitivity to mitotane, a chemotherapeutic drug used in adrenocortical carcinoma treatment, at concentrations within the therapeutic window (14-20 mg/l) . Conversely, FATE1 knockdown significantly increases sensitivity to mitotane.

Notably, FATE1's protective effect appears selective for certain apoptotic pathways, as it does not protect against staurosporine-induced apoptosis, which operates through distinct mechanisms .

How might FATE1 interact with mitochondrial dynamics proteins?

FATE1 exhibits intriguing relationships with the mitochondrial fusion/fission machinery:

Despite its sequence similarity to Mff (mitochondrial fission factor), FATE1 exerts opposite effects on mitochondrial morphology. While Mff recruits Drp1 to facilitate fission, FATE1 does not recruit Drp1 and instead promotes mitochondrial hyperfusion . This suggests an evolutionary divergence in function despite structural similarities.

Co-immunoprecipitation experiments reveal that FATE1 interacts with Mfn2 but not Mfn1, two key mitochondrial fusion proteins . Reconstitution experiments in Mfn1/Mfn2 double knockout mouse embryonic fibroblasts confirm the specific role of Mfn2 in FATE1-mediated effects on mitochondrial morphology .

Additional FATE1-interacting proteins identified include:

  • Emerin (EMD), an inner nuclear membrane protein

  • Mic60/mitofilin, a component of the MICOS complex

  • GRP75, a chaperone protein

These interactions suggest FATE1 may function within a larger protein complex that regulates mitochondrial morphology and ER-mitochondria communication.

What is known about FATE1's role in pathological conditions?

FATE1 has emerged as a significant factor in cancer biology:

As a cancer-testis antigen (CTA), FATE1 is aberrantly expressed in multiple cancer types despite its normally restricted expression pattern. Overexpression has been documented in hepatocellular carcinoma, gastric cancer, colon cancer, and adrenocortical carcinoma (ACC) .

Functional studies identify FATE1 as an essential survival factor across multiple cancer types. Depletion of FATE1 leads to >30% reduction in viability in melanoma, breast, prostate, and sarcoma cell lines . A subset of cancer cell lines (HCT116, WHIM12, U2OS, HeLa, ES-2, PEO1, SUM159, A549, LNCaP) exhibits almost complete loss of viability following FATE1 knockdown .

How might targeting FATE1 enhance therapeutic outcomes?

The critical role of FATE1 in cancer cell survival and treatment resistance suggests several therapeutic opportunities:

  • Restoring Chemosensitivity: FATE1 knockdown sensitizes cancer cells to chemotherapeutic agents including mitotane and paclitaxel . This suggests that FATE1 inhibition could be an effective approach to overcome chemoresistance.

  • Targeting Apoptotic Evasion: By disrupting FATE1's ability to uncouple ER-mitochondria contacts, therapeutic approaches could restore normal calcium-dependent apoptotic signaling in cancer cells .

  • Combination Therapies: FATE1 inhibition could potentially synergize with therapies that activate ER stress or depend on mitochondrial calcium uptake to induce cell death.

  • Cancer Immunotherapy: As a cancer-testis antigen with restricted normal tissue expression, FATE1 represents a potential target for cancer immunotherapy approaches, including targeted antibodies or CAR-T cell development.

Given its role across multiple cancer types and specific mechanistic functions, FATE1-targeting therapies might have broad applicability while potentially minimizing off-target effects in normal tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.