Recombinant Bovine FUN14 domain-containing protein 1 (FUNDC1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which may serve as a reference for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FUNDC1; FUN14 domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-155
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MATRNPPPQEYESDDDSYEVLDLTEYARRHHWWNRVFGHSSGPMVEKYSVATQIVMGGVS GWCAGFLFQKVGKLAATAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKA APEINNIIEEATEFVKQNIVISSGFVGGFLLGLAS
Uniprot No.

Target Background

Function

Acts as an activator of hypoxia-induced mitophagy, a critical mechanism for mitochondrial quality control.

Database Links
Protein Families
FUN14 family
Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is bovine FUNDC1 and what is its primary function?

    Bovine FUNDC1 (FUN14 domain-containing protein 1) is an integral mitochondrial outer-membrane protein comprising 155 amino acids. The primary function of FUNDC1 is mediating mitophagy, the selective autophagic removal of dysfunctional mitochondria, particularly under hypoxic conditions. Studies have demonstrated that bovine FUNDC1 shows 100% sequence homology with deposited GenBank sequences (accession number: NM_001104982) . The protein is especially abundant in tissues with high energy demands such as cardiac and skeletal muscles, suggesting tissue-specific regulatory roles .

  • How is recombinant bovine FUNDC1 typically produced for research applications?

    Recombinant bovine FUNDC1 is typically produced using E. coli expression systems with an N-terminal His-tag for purification purposes. The full-length protein (1-155aa) is expressed and purified using affinity chromatography. The recombinant protein is generally lyophilized and stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 . For optimal stability, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL and addition of 5-50% glycerol is recommended before aliquoting for long-term storage at -20°C/-80°C .

  • What detection methods are most effective for bovine FUNDC1 in experimental systems?

    Multiple detection methods have proven effective for bovine FUNDC1:

    MethodApplicationsConsiderations
    Western blottingProtein expression quantificationRecommended with His-tag antibodies for recombinant protein
    PCR amplificationGene expression analysisFUNDC1 receptor can be amplified by PCR with high specificity
    ImmunohistochemistryTissue localizationFixation methods may affect epitope recognition
    ImmunofluorescenceSubcellular localizationParticularly useful for co-localization studies with mitochondrial markers

    For optimal results, comparing transcript levels (qRT-PCR) with protein levels (Western blot) is recommended, as studies have shown discrepancies between FUNDC1 mRNA and protein levels under certain conditions like hypoxia .

Practical Application Questions

  • How can recombinant bovine FUNDC1 be used to develop therapeutic strategies for neurodegenerative diseases?

    Recombinant bovine FUNDC1 offers promising therapeutic potential for neurodegenerative conditions:

    1. Neuroprotective Mechanisms:

      • FUNDC1 overexpression has been shown to protect against neuronal loss after spinal cord injury

      • It enhances mitophagy, preventing the accumulation of damaged mitochondria that contribute to neurodegeneration

      • FUNDC1 inhibits mitochondria-dependent apoptosis through modulation of Bax/Bcl-2 ratio and caspase activation

    2. Therapeutic Development Approaches:

      • Gene therapy vectors expressing FUNDC1 for targeted delivery to affected tissues

      • Small molecule modulators that enhance FUNDC1-mediated mitophagy

      • Cell-penetrating peptides derived from FUNDC1's LC3-binding domain

      • Combination approaches targeting both FUNDC1 and other mitophagy pathways

    Research indicates that FUNDC1 activation significantly improves functional recovery in spinal cord injury models, with enhanced BBB scores from 72 hours to 7 days post-injury compared to control groups . These findings suggest that therapies targeting FUNDC1-mediated mitophagy could provide neuroprotection in various neurodegenerative contexts where mitochondrial dysfunction plays a central role.

  • What are the methodological approaches for investigating FUNDC1's role in cardiac function and heart failure?

    Investigating FUNDC1's cardiac functions requires specialized methodologies:

    1. Cardiac-Specific Models:

      • Cardiomyocyte-specific FUNDC1 knockout or overexpression models

      • In vitro cardiomyocyte cultures under normoxic and hypoxic conditions

      • Ex vivo working heart preparations for functional assessments

      • In vivo cardiac function monitoring (echocardiography, pressure-volume loops)

    2. Analytical Approaches:

      • ER-mitochondria contact site quantification through electron microscopy

      • Calcium flux measurements between ER and mitochondria

      • Mitochondrial morphology and dynamics assessment

      • Cardiac energetics evaluation (ATP production, oxygen consumption)

    Research has demonstrated that FUNDC1 reduction initiates cardiac dysfunction and heart failure . Analysis of human heart specimens revealed significantly reduced FUNDC1 levels in heart failure patients compared to control donors, with corresponding decreases in ER-mitochondria contacts and altered mitochondrial morphology . These findings establish FUNDC1 as a critical regulator of cardiac function through its role in MAM formation and mitochondrial homeostasis.

  • How can recombinant bovine FUNDC1 be utilized to study chemoresistance mechanisms in cancer models?

    Recombinant bovine FUNDC1 provides valuable tools for investigating chemoresistance mechanisms:

    1. Experimental Design Approaches:

      • Overexpression or knockdown of FUNDC1 in cancer cell lines before chemotherapy treatment

      • Assessment of cell survival, apoptosis, and mitophagy markers

      • Platinum sensitivity assays with varying FUNDC1 expression levels

      • Combination treatments targeting both FUNDC1 and conventional chemotherapeutics

    2. Key Research Findings:

      • High FUNDC1 expression correlates with platinum-based chemotherapy resistance in endometrial cancer patients

      • Patients with elevated FUNDC1 levels show higher recurrence rates within one year of chemotherapy

      • FUNDC1 knockdown increases chemosensitivity by reducing mitophagy

      • FUNDC1 silencing decreases HIF-1α expression and LC3 conversion, reducing mitophagy-mediated chemoresistance

    These findings suggest that targeting FUNDC1-mediated mitophagy could potentially overcome chemoresistance in cancer treatment. Methodologically, combining recombinant FUNDC1 with mitophagy inhibitors may provide synergistic effects in enhancing chemotherapeutic efficacy.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.