Recombinant Bovine Furin (FURIN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment according to your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FURIN; FUR; PACE; Furin; Dibasic-processing enzyme; Paired basic amino acid residue-cleaving enzyme; Trans Golgi network protease furin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
108-797
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
FURIN
Target Protein Sequence
DIYQEPTDPKFPQQWYLSGVTQRDLNVKEAWAQGYTGRGIVVSILDDGIEKNHPDLAGNY DPGASFDVNDQDPDPQPRYTQMNDNRHGTRCAGEVAAVANNGVCGVGVAYNARIGGVRML DGEVTDAVEARSLGLNPNHIHIYSASWGPEDDGKTVDGPAHLAEEAFFRGVSQGRGGLGS IFVWASGNGGREHDSCNCDGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQN EKQIVTTDLRQKCTESHTGTSAFAPLAAGIIALTLEANKNLTWRDMQHLVVRTSKPAHLN ANDWATNGVGRKVSHSYGYGLLDAGAMVALAQNWTTVAPQRKCTIDILTEPKDIGKRLEV RKTVTACLGEPSHITRLEHAQARLTLSYNRRGDLAIHLVSPMGTRSTLLAARPHDYSADG FNDWAFMTTHSWDEDPSGEWVLEIENTSEANNYGTLTKFTLVLYGTAPEGLPTPPESIGC KTLTSSQACVVCEEGFSLHQKNCVQHCPPGFAPQVLDTHYSTENDVEIIRASVCTPCHAS CATCQGPAPTDCLSCPSHASLDPVEQTCSRQSQSSRESHQQQPPPPPRPPPAEVATEPRL RADLLPSHLPEVVAGLSCAFIVLVFVTVFLVLQLRSGFSFRGVKVYTMDRGLISYKGLPP EAWQEECPSDSEEDEGRGERTAFIKDQSAL
Uniprot No.

Target Background

Function
Recombinant Bovine Furin is a ubiquitous endoprotease within constitutive secretory pathways. It cleaves at the RX(K/R)R consensus motif and mediates the processing of TGF-β1, a crucial step in its activation.
Database Links
Protein Families
Peptidase S8 family, Furin subfamily
Subcellular Location
Golgi apparatus, trans-Golgi network membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Secreted. Endosome membrane; Single-pass type I membrane protein.

Q&A

What is bovine furin and what is its primary function?

Bovine furin is a calcium-dependent serine endoprotease belonging to the subtilisin-like proprotein convertase family. It primarily functions to cleave precursor proteins at specific recognition sequences, typically characterized by basic amino acid motifs. In viral systems, furin recognizes and cleaves at consensus sequences such as RKRR and RAKR, as demonstrated in bovine respiratory syncytial virus (BRSV) fusion proteins . This proteolytic processing is essential for the maturation and activation of various proteins, including viral envelope glycoproteins.

Furin predominantly localizes to the trans-Golgi network within cells but can also be found in endosomes and at the cell surface. Its activity is crucial for numerous cellular processes including hormone and growth factor activation, receptor processing, and extracellular matrix protein maturation. In viral pathogenesis, furin-mediated cleavage often represents a critical step in viral entry and fusion mechanisms, making it an important target for antiviral research strategies.

When examining the bovine respiratory syncytial virus system, furin cleavage results in the generation of disulfide-linked F₁ and F₂ subunits and the release of an intervening peptide of 27 amino acids (pep27) . This processing pattern highlights the precision with which furin recognizes and cleaves its substrates at specific motifs within protein sequences.

How does furin cleavage affect viral protein function?

Furin-mediated cleavage significantly impacts viral protein functionality, particularly for fusion proteins involved in viral entry. In BRSV, the fusion (F) protein undergoes cleavage at two furin cleavage sites, designated as FCS-1 (RKRR) and FCS-2 (RAKR), which results in the generation of the disulfide-linked F₁ and F₂ subunits . This proteolytic processing is essential for the activation of fusion activity, enabling the virus to enter host cells.

The importance of furin cleavage extends beyond BRSV to other viral systems. In SARS-CoV-2, disruption of the furin cleavage site significantly attenuates replication in human respiratory cells in vitro and reduces pathogenesis in vivo . This underscores the critical role furin plays in viral infectivity across different viral families.

How can recombinant bovine furin be used to study viral protein processing?

Recombinant bovine furin serves as a valuable tool for investigating proteolytic processing events in viral proteins. Researchers can employ purified recombinant furin in in vitro cleavage assays to examine the processing of viral fusion proteins and understand the sequence requirements for efficient cleavage. This approach allows for the detailed characterization of cleavage site preferences and the identification of critical residues within the consensus sequence.

One experimental approach involves creating mutated versions of viral proteins with modified furin cleavage sites and assessing how these changes impact processing. For instance, studies with BRSV F protein demonstrated that replacing the native pep27 sequence with bovine cytokines (boIL2, boIL4, or boIFN-gamma) resulted in the secretion of these cytokines into the culture medium, while still allowing for furin-mediated processing of the F protein . This showcases how the F protein can be used as a vehicle to express secreted heterologous bioactive peptides or glycoproteins, which might have applications in vaccine development.

To analyze furin cleavage in cell culture systems, researchers typically employ methods such as:

  • Western blotting with antibodies specific to different domains of the target protein

  • Pulse-chase experiments to track the kinetics of proteolytic processing

  • Immunofluorescence microscopy to visualize the cellular localization of processed proteins

  • Mass spectrometry to precisely identify cleavage sites and processing intermediates

These techniques collectively provide a comprehensive understanding of how furin cleavage influences viral protein maturation and function.

What methodological approaches can be used to assess furin cleavage efficiency?

Assessing furin cleavage efficiency requires robust methodological approaches that can quantitatively measure proteolytic processing. Several techniques have been established for this purpose, each with specific advantages depending on the research question.

For in vitro analysis of furin activity, fluorogenic peptide substrates containing the consensus cleavage sequence and a fluorophore-quencher pair can be used. Upon cleavage by furin, the fluorophore is separated from the quencher, resulting in increased fluorescence that can be measured in real-time. This allows for kinetic analysis of cleavage efficiency and the determination of enzymatic parameters such as Km and Vmax.

In cell-based systems, western blotting under non-reducing conditions provides valuable information about the processing state of target proteins. As demonstrated in studies with recombinant BRSV, viral proteins can be analyzed by SDS-PAGE followed by immunoblotting with monoclonal antibodies directed against specific protein domains . The relative intensities of bands corresponding to uncleaved precursors versus cleaved products can be quantified to determine cleavage efficiency.

RT-PCR analysis can complement protein-level studies by confirming the genetic integrity of recombinant constructs. As described in the BRSV research, total RNA from infected cells can be reverse transcribed, and specific regions of the viral genome can be amplified to verify the presence of introduced mutations in furin cleavage sites . This ensures that any observed changes in protein processing are due to the intended modifications rather than spontaneous mutations.

For more complex analyses, pulse-chase experiments combined with immunoprecipitation allow researchers to track the temporal dynamics of furin-mediated cleavage. By pulse-labeling newly synthesized proteins and following their maturation over time, the kinetics of proteolytic processing can be determined with high precision.

How do mutations in furin cleavage sites affect protein maturation and viral pathogenesis?

Mutations in furin cleavage sites can profoundly impact protein maturation and viral pathogenesis, providing valuable insights into the molecular mechanisms underlying viral infection. Research with BRSV has shown that the specific sequence of the intervening peptide between furin cleavage sites influences intracellular transport, maturation of the F protein, and F-mediated syncytium formation . These findings highlight the structural and functional significance of furin-mediated processing.

In studies with recombinant BRSV mutants containing modified furin cleavage sites, researchers observed that changes in the FCS-2 motif (e.g., R106N/K108N or K108N/R109N) affected viral entry and replication . Even more striking, a complete deletion mutant lacking 25 amino acids including FCS-2 and most of pep27 could still be recovered, indicating that while furin cleavage influences viral properties, it may not be absolutely essential for basic viral replication in some contexts.

The impact of furin cleavage site mutations extends to other viral systems as well. In SARS-CoV-2, disruption of the furin cleavage site (PRRARS to PQQARS) resulted in:

  • Attenuated replication in human respiratory cells

  • Reduced pathogenesis in animal models

  • Altered tissue tropism with increased replication in upper airways but decreased lung infection

  • Maintained transmission capability but with reduced efficiency

These findings demonstrate that furin cleavage sites play nuanced roles in viral pathogenesis, potentially influencing tissue tropism, cell entry mechanisms, and transmission dynamics. The table below summarizes key observations from studies examining furin cleavage site mutations in different viral systems:

Viral SystemMutationEffect on Protein ProcessingEffect on Viral PhenotypeReference
BRSVR106N/K108N at FCS-2Abolished cleavage at FCS-2Viable virus with altered cell entry
BRSVK108N/R109N at FCS-2Abolished cleavage at FCS-2Viable virus with altered cell entry
BRSVR106S/K108N/R109N at FCS-2Complete loss of FCS-2 cleavageViable virus
BRSVΔ106-130 (deletion)Removal of FCS-2 and most of pep27Viable virus
SARS-CoV-2PRRAR to PQQARInhibited spike processingAttenuated pathogenesis but maintained transmission

How can recombinant bovine furin be used to develop antiviral strategies?

Recombinant bovine furin provides a valuable platform for developing and testing antiviral strategies targeting furin-dependent viral entry mechanisms. Since many viruses rely on furin-mediated cleavage for activation of their fusion proteins, inhibiting this process represents a potential broad-spectrum antiviral approach.

Researchers can use recombinant bovine furin in high-throughput screening assays to identify compounds that specifically inhibit furin activity. These inhibitors can then be evaluated for their ability to block viral entry and replication in cell culture systems. The advantage of targeting host furin rather than viral proteins is the reduced likelihood of viral resistance development, as the virus cannot easily mutate to escape the effects of host protease inhibition.

Another innovative approach involves using furin cleavage sites as insertion points for immunomodulatory molecules. As demonstrated in studies with BRSV, the region between two furin cleavage sites can be replaced with sequences encoding cytokines or other bioactive peptides . Upon infection, these molecules are released through furin-mediated cleavage, potentially enhancing the immune response against the virus. This strategy could be exploited for the development of novel vaccine candidates that not only present viral antigens but also deliver immunostimulatory signals.

The efficacy of furin-targeting antiviral strategies can be evaluated using recombinant viruses with reporter genes inserted into their genomes. By monitoring reporter gene expression in the presence of furin inhibitors or in cells with modified furin expression, researchers can quantitatively assess the impact of these interventions on viral replication. This approach allows for rapid screening of candidate compounds and facilitates the identification of promising leads for further development.

What are the optimal conditions for recombinant bovine furin activity in vitro?

Establishing optimal conditions for recombinant bovine furin activity is crucial for consistent and reliable experimental outcomes. Furin is a calcium-dependent serine protease that functions optimally under specific biochemical parameters that researchers should carefully control.

The pH optimum for furin activity typically ranges between 7.0-7.5, reflecting its primary localization in the trans-Golgi network and endosomal compartments. The enzyme requires calcium ions for structural integrity and catalytic function, with optimal activity observed at calcium concentrations of 1-2 mM. Additionally, furin activity is enhanced in the presence of reducing agents such as β-mercaptoethanol or dithiothreitol at low concentrations (0.1-1 mM), which help maintain the proper redox environment for the enzyme.

For in vitro cleavage assays, researchers typically use buffer systems containing:

  • 100 mM HEPES or MES buffer (pH 7.0-7.5)

  • 1 mM CaCl₂

  • 0.5% Triton X-100 or 0.1% CHAPS (to prevent non-specific adsorption)

  • 0.1-1 mM β-mercaptoethanol or dithiothreitol

  • Protease inhibitor cocktail lacking serine protease inhibitors

When examining furin activity in cell culture systems, researchers must consider the presence of endogenous proteases that might contribute to observed cleavage events. As demonstrated in studies with recombinant BRSV, the addition of exogenous proteases such as trypsin can bypass the requirement for furin-mediated cleavage in some contexts . Therefore, careful experimental design is necessary to distinguish between furin-specific effects and those mediated by other proteases.

How can researchers differentiate between furin and other protease activities in experimental systems?

Distinguishing furin activity from other proteases presents a methodological challenge that requires careful experimental approaches. Researchers can employ several strategies to achieve specificity in their analyses.

One approach involves using specific furin inhibitors such as decanoyl-RVKR-chloromethylketone (CMK) or α1-antitrypsin Portland (α1-PDX), which selectively block furin activity without affecting most other proteases. By comparing protein processing in the presence and absence of these inhibitors, researchers can attribute observed cleavage events specifically to furin. Similarly, small interfering RNA (siRNA) or CRISPR-Cas9-mediated knockdown/knockout of furin expression can provide genetic evidence for furin-dependent processes.

The use of cell lines deficient in furin activity, such as the LoVo cell line, offers another approach. By expressing recombinant proteins in these cells and comparing their processing to that observed in furin-expressing cells, researchers can directly assess the contribution of furin to proteolytic events. This strategy was implicitly utilized in studies of recombinant BRSV, where the processing of F proteins with modified furin cleavage sites was examined .

Site-directed mutagenesis of furin consensus sequences provides perhaps the most definitive evidence for furin-specific cleavage. By systematically altering residues within the recognition motif (e.g., changing RAKR to NANR as demonstrated in BRSV studies), researchers can establish the sequence requirements for furin-mediated processing . This approach can be complemented by mass spectrometry analysis to precisely identify cleavage sites and confirm that processing occurs at the expected positions.

In competition assays, researchers can include synthetic peptides containing furin cleavage sites to competitively inhibit the processing of the target protein. The degree of inhibition observed with different peptide sequences can provide insights into the relative affinity of furin for various substrates and help distinguish furin-mediated cleavage from that catalyzed by other proteases with different sequence preferences.

How can recombinant bovine furin be utilized in vaccine development strategies?

Recombinant bovine furin offers innovative possibilities for vaccine development through multiple mechanisms. The enzyme's ability to process viral proteins at specific cleavage sites can be harnessed to create novel vaccine platforms that enhance immunogenicity and efficacy.

One promising approach involves using the furin cleavage site as an insertion point for immunomodulatory molecules within viral proteins. Studies with BRSV have demonstrated that replacing the intervening peptide between furin cleavage sites with bovine cytokines (boIL2, boIL4, or boIFN-gamma) resulted in the secretion of these cytokines into the culture medium upon furin-mediated cleavage . This creates a dual-function vaccine candidate that not only presents viral antigens but also delivers immune-stimulating cytokines to enhance the protective response.

Another application lies in the development of subunit vaccines based on recombinant viral envelope proteins with modified furin cleavage sites. Research with Bovine Leukemia Virus (BLV) has shown that a soluble furin-mutated BLV Env ectodomain (sBLV-EnvFm) expressed in insect cells can be recognized by antibodies from BLV-infected cattle and elicit robust humoral immune responses in mice . This demonstrates the potential of furin-modified viral proteins as effective diagnostic tools and vaccine components.

The importance of furin cleavage in viral pathogenesis suggests that modulating this process could yield attenuated viruses suitable for live-attenuated vaccine development. Studies with SARS-CoV-2 have shown that disruption of the furin cleavage site attenuates pathogenesis while maintaining transmission capability . This balance between attenuation and immunogenicity represents an ideal profile for live-attenuated vaccine candidates, potentially providing protection without causing disease.

For optimal vaccine design utilizing furin cleavage properties, researchers should consider:

  • The location and accessibility of furin cleavage sites within target antigens

  • The stability of modified proteins following furin processing

  • The potential impact of modifications on protein conformation and epitope presentation

  • The cellular location of furin-mediated cleavage and its implications for antigen processing and presentation

What are the latest techniques for studying furin-substrate interactions at the molecular level?

Advanced molecular techniques have revolutionized our understanding of furin-substrate interactions, providing unprecedented insights into the structural basis of substrate recognition and processing. These methodologies enable researchers to study furin-mediated cleavage with remarkable precision and detail.

Cryo-electron microscopy (cryo-EM) has emerged as a powerful tool for visualizing furin-substrate complexes at near-atomic resolution. By capturing the enzyme in different conformational states, including substrate-bound forms, researchers can identify critical interactions that govern specificity and catalytic efficiency. These structural insights can inform rational design of furin inhibitors and substrate analogs for various applications.

Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers complementary information about protein dynamics and binding interfaces. This technique measures the exchange rate of hydrogen atoms in a protein with deuterium from the solvent, which is influenced by protein structure and ligand binding. By comparing HDX patterns of furin in the presence and absence of substrates or inhibitors, researchers can map binding sites and conformational changes associated with substrate recognition.

Surface plasmon resonance (SPR) and bio-layer interferometry (BLI) enable real-time monitoring of furin-substrate binding kinetics without the need for fluorescent or radioactive labels. These techniques can determine association and dissociation rates as well as binding affinities, providing quantitative parameters for comparing different substrates or mutants. Such information is valuable for understanding the energetics of furin-substrate interactions and predicting cleavage efficiency.

For high-throughput analysis of substrate preferences, peptide arrays containing systematic variations of furin cleavage motifs can be employed. By incubating these arrays with recombinant furin and detecting cleavage events through mass spectrometry or other methods, researchers can generate comprehensive profiles of sequence preferences beyond the canonical RXXR motif. This approach has revealed subtle differences in substrate recognition that may influence processing efficiency in different cellular contexts.

Molecular dynamics simulations complement experimental approaches by predicting the behavior of furin-substrate complexes over time scales not accessible to direct observation. These computational methods can model the conformational changes that occur during substrate binding and catalysis, providing mechanistic insights into the cleavage process. When integrated with experimental data, simulations offer a more complete understanding of the factors governing furin-substrate interactions at the molecular level.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.