Recombinant Bovine G-protein coupled receptor 183 (GPR183)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine GPR183

GPR183 (Gene: EBI2) is a G protein-coupled receptor (GPCR) involved in signaling pathways critical for immune responses, lipid metabolism, and cellular proliferation. The recombinant bovine variant is a genetically engineered protein produced in vitro for research applications. It retains the structural and functional properties of endogenous GPR183, enabling studies on its role in biological systems.

Production and Purification Methods

Recombinant bovine GPR183 is synthesized via heterologous expression systems:

  • Host Organisms: E. coli (common for bacterial expression), yeast, or mammalian cells .

  • Purification: Affinity chromatography (e.g., Ni-NTA for His-tagged proteins) .

  • Applications: Used in functional assays, signaling pathway studies, and antibody development .

Experimental and Functional Validation

Recombinant GPR183 is validated in:

  • Western Blotting: Detects protein expression in cell lysates .

  • Functional Assays:

    • mTOR Phosphorylation: LY294002 (PI3K inhibitor) abrogates GPR183-driven mTOR activation .

    • Cell Proliferation: GPR183 overexpression increases cell count in HC11 cells .

Challenges and Future Directions

  • Species-Specific Data Gaps: Most studies focus on human/mouse homologs; bovine-specific functional studies are needed.

  • Therapeutic Potential: Exploring GPR183 as a target for improving lactation efficiency or immune modulation in cattle.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type requirements, please inform us and we will prioritize development according to your specifications.
Synonyms
GPR183; G-protein coupled receptor 183
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MDIKMDNFTTPSAASLESDCDLYAHHHTARILMPLHYSIVFIIGLVGNLLALIVIIQNRK KINSTTLYSTNLVISDILFTTALPTRIAYYALGFDWRIGDALCRITALVFYINTYAGVNF MTCLSIDRFFAVVHPLRYNKIKRIEHAKCICIFVWILVFGQTLPLLINPMSKQEAERTTC MEYPNFEETKSLPWILLGACFIGYVLPLVIILICYSQICCKLFKTAKQNPLTEKSGVNKK ALNTIIFIIVVFVVCFTPYHVAIIQHMIKKLRLPGLLECSQRHSFQISLHFTVCLMNFNC CMDPFIYFFACKGYKRKVMKMLKRQVSVSISSAVRSAPEENSREMTETQMMIHSKSLNGK
Uniprot No.

Target Background

Function
G-protein coupled receptor 183 (GPR183) is a lymphocyte-expressed receptor that functions as a chemotactic receptor for various cell types, including B-cells, T-cells, splenic dendritic cells, monocytes/macrophages, and astrocytes. It acts as a receptor for the oxysterol 7-alpha,25-dihydroxycholesterol (7-alpha,25-OHC) and other related oxysterols. GPR183 mediates cell positioning and movement by binding to the 7-alpha,25-OHC ligand, which forms a chemotactic gradient. Binding of 7-alpha,25-OHC facilitates the accurate localization of B-cells during humoral immune responses. It guides B-cell movement along the B-cell zone-T-cell zone boundary and subsequently to interfollicular and outer follicular regions. Its specific expression during B-cell maturation helps to position B-cells appropriately for mounting T-dependent antibody responses. In collaboration with CXCR5, GPR183 mediates B-cell migration, potentially by forming a heterodimer with CXCR5 that influences the interaction between CXCL13 and CXCR5. Additionally, GPR183 functions as a chemotactic receptor for certain T-cells upon binding to the 7-alpha,25-OHC ligand. It promotes follicular helper T (Tfh) cells differentiation by positioning activated T-cells at the follicle-T-zone interface, facilitating contact between newly activated CD4 T-cells and activated dendritic cells, and exposing them to Tfh-cell-promoting inducible costimulator (ICOS) ligand. The expression of GPR183 in splenic dendritic cells is crucial for their homeostasis, localization, and ability to induce B- and T-cell responses. It serves as a chemotactic receptor in dendritic cells, mediating the accumulation of CD4(+) dendritic cells in bridging channels. GPR183 regulates astrocyte migration and plays a role in communication between astrocytes and macrophages. It promotes the migration of osteoclast precursors to bone surfaces. GPR183 signals constitutively through G(i)-alpha, but not G(s)-alpha or G(q)-alpha. It also signals constitutively via MAPK1/3 (ERK1/2).
Database Links

KEGG: bta:540287

UniGene: Bt.55635

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of GPR183 in the immune system?

GPR183 plays a crucial role in immune cell migration and positioning, particularly for B cells during germinal center reactions. The receptor responds to oxysterol gradients, which act as chemoattractants for GPR183+ cells. This interaction regulates the positioning of immune cells within secondary lymphoid organs and affects B-cell motility . Additionally, GPR183 is involved in macrophage recruitment during inflammatory responses, with its expression positively correlating with pro-inflammatory cytokines like IL-6 and TNF . In the context of immune surveillance, GPR183 facilitates the recognition and elimination of malignant B cells, particularly when CD20, CD47, and PI3Kδ pathways are simultaneously targeted .

How can I measure GPR183 expression in experimental systems?

For quantifying GPR183 expression, multiple complementary techniques can be employed:

  • Flow cytometry (FACS): This method allows for quantification of surface GPR183 protein expression in specific immune cell subtypes. Peripheral blood mononuclear cells can be isolated, stained with fluorescent-labeled antibodies against GPR183 and other cell surface markers (like CCR6), and analyzed to determine expression levels in different cell populations .

  • Quantitative PCR (qPCR): Total RNA can be isolated using standard RNA extraction kits (e.g., ISOLATE II RNA Mini Kit), followed by reverse transcription and qPCR using GPR183-specific primers. Expression can be normalized to reference genes like HPRT using the 2^-ΔCt method .

  • Western blotting: Protein levels can be measured using specific anti-GPR183 antibodies, with loading controls like GAPDH. Densitometric quantification provides relative expression values .

  • Immunohistochemistry (IHC): This technique is valuable for assessing GPR183 expression in tissue samples, offering spatial context to expression patterns .

What experimental models are suitable for studying GPR183 function?

Several experimental models have been validated for GPR183 research:

  • Cell culture systems: Co-culture models using GPR183-expressing cells (either natural or recombinant) with other immune cells (e.g., macrophages) can be established to study cell-cell interactions. 3D spheroid models that incorporate stromal cells provide a more physiologically relevant microenvironment .

  • Genetic manipulation: CRISPR/Cas9 gene editing can generate GPR183 knockout cell lines to investigate receptor-dependent processes. This approach has been successfully used to create Raji-GPR183 KO clones for functional studies .

  • Animal models: GPR183-deficient mice (Gpr183^-/-) are valuable for in vivo functional studies. These can be challenged with infectious agents or inflammatory stimuli to assess GPR183's role in disease pathogenesis .

  • Xenograft models: Human cells expressing or lacking GPR183 can be implanted into immunodeficient mice or chorioallantoic membrane (CAM) models to study tumor growth and immune cell infiltration in vivo .

How does GPR183 polymorphism affect receptor function and disease susceptibility?

Single nucleotide polymorphisms (SNPs) in the GPR183 gene have been associated with inflammatory conditions. The rs9557195 polymorphism increases the risk for inflammatory bowel diseases (IBD) and affects GPR183 surface expression on blood lymphocytes . When investigating GPR183 polymorphisms:

  • Genotype-phenotype correlation studies should include:

    • Genotyping patient cohorts for known GPR183 polymorphisms

    • Quantifying receptor surface expression using flow cytometry

    • Correlating expression levels with disease severity and clinical outcomes

    • Assessing functional differences in receptor signaling or ligand binding

  • Functional validation can be performed through:

    • Site-directed mutagenesis to introduce specific polymorphisms into recombinant expression systems

    • Comparison of wild-type and mutant receptor trafficking, surface expression, and downstream signaling

    • Migration assays to evaluate changes in chemotactic responses to oxysterol gradients

Understanding these polymorphisms may provide insights into disease mechanisms and identify potential therapeutic targets or biomarkers for stratifying patients .

What are the methodological considerations for studying GPR183-mediated phagocytosis?

GPR183 plays a crucial role in macrophage-mediated phagocytosis of malignant B cells. When designing experiments to study this process:

  • Phagocytosis assay optimization:

    • Label target cells with pH-sensitive fluorescent dyes (e.g., pHrodo) that increase fluorescence in acidic phagolysosomes

    • Co-culture labeled cells with primary M1-polarized macrophages

    • Quantify engulfed cell fluorescence to measure antibody-dependent cellular phagocytosis (ADCP)

    • Include appropriate controls (GPR183-deficient cells, receptor antagonists)

  • F-actin polymerization assessment:

    • GPR183 activation affects F-actin organization, which impacts cell migration

    • Stain cells with fluorescent phalloidin after treatment

    • Quantify changes in polymerized actin as a readout of GPR183 activity

    • Compare wild-type cells with GPR183-deficient or antagonist-treated cells

  • Transwell migration assays:

    • Use recombinant chemokines (e.g., CXCL12) as chemoattractants

    • Assess how GPR183 activation or inhibition affects chemokine-mediated migration

    • Evaluate the crosstalk between GPR183 and other chemokine receptors

How can I investigate GPR183 signaling pathways and downstream effectors?

Comprehensive analysis of GPR183 signaling requires multi-parameter approaches:

  • Transcriptomic analysis:

    • RNA-seq or microarray analysis of cells with manipulated GPR183 expression/activity

    • Gene set enrichment analysis (GSEA) to identify activated or repressed pathways

    • Validation of key differentially expressed genes by qPCR

    • Comparison across different experimental conditions and model systems

  • Protein-protein interaction studies:

    • Immunoprecipitation of GPR183 followed by mass spectrometry

    • Proximity ligation assays to detect in situ interactions

    • BRET/FRET approaches to study dynamic interactions in living cells

  • Signaling cascade analysis:

    • Phosphorylation status of downstream effectors (Western blotting, phospho-specific antibodies)

    • Small molecule inhibitors of specific pathway components

    • Time-course experiments to determine signaling kinetics

    • Integration with PI3K/Akt signaling, which has been identified as a downstream axis affected by co-targeting of CD20 and PI3Kδ

How can I distinguish between direct GPR183 effects and indirect immune modulatory consequences?

GPR183 functions within complex immune networks, making it challenging to isolate direct receptor effects from broader immune responses:

  • Cell-specific deletion/inhibition:

    • Use cell type-specific promoters for conditional Cre-lox deletion in animal models

    • Adoptive transfer experiments with mixed populations of GPR183-competent and -deficient cells

    • Time-resolved inhibition using inducible systems or acute antagonist administration

  • Ex vivo analysis of isolated cell populations:

    • Sort specific immune cell subsets from experimental animals

    • Perform functional assays on purified populations

    • Compare responses between GPR183-expressing and non-expressing cells within the same microenvironment

  • Multi-parameter readouts:

    • Combine transcriptomic, proteomic, and functional assays

    • Establish temporal relationships between GPR183 activation and downstream events

    • Use systems biology approaches to model direct and indirect effects

What factors should be considered when using GPR183 antagonists in research?

GPR183 antagonists like NIBR189 are valuable tools for receptor function studies but require careful experimental design:

  • Pharmacokinetic/pharmacodynamic considerations:

    • Determine appropriate dosing regimens (e.g., 7.6 mg/kg twice daily for NIBR189)

    • Establish administration routes (oral gavage has been validated)

    • Assess tissue distribution, especially to target organs of interest

    • Consider washout periods for reversibility studies

  • Selectivity profiling:

    • Test antagonist specificity against related GPCRs

    • Establish dose-response relationships for on-target vs. off-target effects

    • Include appropriate vehicle controls (e.g., 0.5% carboxymethylcellulose/0.5% Tween-80 for NIBR189)

    • Validate functional blockade through migration or signaling assays

  • Comparative approaches:

    • Compare antagonist effects with genetic deletion models

    • Assess whether phenotypes are recapitulated across different inhibition strategies

    • Consider potential compensatory mechanisms in chronic inhibition settings

How can GPR183 expression be leveraged as a biomarker in disease contexts?

GPR183 expression correlates with disease outcomes in several contexts, suggesting potential biomarker applications:

  • Prognostic biomarker development:

    • Upregulation of GPR183 is associated with better prognosis in diffuse large B-cell lymphoma (DLBCL) patients treated with R-CHOP immunochemotherapy

    • Standardize quantification methods for clinical application

    • Establish reference ranges and clinically relevant thresholds

    • Validate in prospective cohort studies

  • Patient stratification approaches:

    • Correlate GPR183 expression with treatment response

    • Determine whether expression predicts sensitivity to specific therapeutic regimens

    • Integrate with other biomarkers for comprehensive patient profiling

    • Develop companion diagnostics for GPR183-targeted therapies

  • Methodological standardization:

    • Develop standardized assays suitable for clinical laboratories

    • Establish quality control metrics and reference materials

    • Compare tissue-based versus liquid biopsy approaches

    • Address pre-analytical variables affecting GPR183 measurement

What is the role of GPR183 in the context of oxysterol gradient formation and sensing?

Oxysterols are natural ligands for GPR183, creating chemotactic gradients that guide immune cell positioning:

  • Oxysterol quantification methodologies:

    • Mass spectrometric approaches for accurate quantification

    • Sample preparation optimization for different tissue types

    • Spatial mapping of oxysterol gradients in tissues

    • Temporal dynamics of gradient formation and dissolution

  • Structure-activity relationship studies:

    • Define the structural requirements for oxysterol binding to GPR183

    • Develop synthetic agonists and antagonists with improved properties

    • Characterize species-specific differences in ligand recognition

    • Identify potential endogenous competitors or modulators

  • Gradient perturbation experiments:

    • Manipulate oxysterol-producing enzymes to alter gradient formation

    • Use oxysterol-sequestering agents to disrupt existing gradients

    • Assess immune cell positioning and function under altered gradient conditions

    • Develop computational models of gradient formation and sensing dynamics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.