Recombinant Bovine G-protein coupled receptor 39 (GPR39)

Shipped with Ice Packs
In Stock

Description

Biological Functions and Mechanisms

Bovine GPR39 mediates zinc-dependent signaling and metabolic regulation:

  • Zinc sensing: Binds extracellular Zn²⁺ at micromolar concentrations, activating Gαq and Gα12/13 pathways .

  • Metabolic regulation: Enhances insulin secretion, lipolysis, and glucose uptake via PI3K/AKT and ERK/MAPK pathways .

  • Cytoprotection: Reduces oxidative stress and apoptosis by inducing cytoprotective factors like PEDF .

Table 2: Signaling Pathways Activated by GPR39

PathwayFunctionRelevance in Bovine Systems
PI3K/AKTEnhances cell survival and proliferationLikely conserved in metabolic tissues
ERK/MAPKPromotes epithelial repairCritical for gastrointestinal health
Gαq/PLCβIncreases intracellular Ca²⁺Modulates hormone secretion

Expression and Detection

  • Recombinant production: Bovine GPR39 is typically expressed in eukaryotic systems (e.g., HEK293 cells) for functional assays .

  • Detection tools: Commercial ELISA kits (e.g., EIAAB E15281b) quantify bovine GPR39 with high specificity (UniProt: B4XF06) .

Functional Insights from Homologs

  • Glucose homeostasis: Rodent studies show GPR39 knockout impairs insulin secretion and glucose tolerance .

  • Disease models: Human GPR39 overexpression mitigates vascular fibrosis and hypertension by regulating NLRP3 inflammasomes .

Applications in Research

  • Drug development: Target for type 2 diabetes and metabolic syndrome therapies .

  • Agricultural studies: Investigates metabolic efficiency in livestock via Zn²⁺-mediated pathways .

  • Assay systems: Used in calcium flux and IP1 accumulation assays to screen agonists .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GPR39; G-protein coupled receptor 39
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MASPSHPSRDCSQVIDHSHVPEFEVATWIKITLILVYLVIFVVGILGNSVTIRVTQVLQK KGYLQKEVTDHMVSLACSDILVFLIGMPMEFYSIIWNPLTTPSYTVSCKVHTFLFEACSY ATLLHVLTLSFERYIAICHPFRYKAMSGPCQVKLLIGFVWVTSALVALPLLFAMGVEYPL VNVPSHRGLICNRSRTRHQEQPESSNMSICTNLSSRWTVFQSSIFSAFVVYLVVLVSVAF MCWSMMQVLRRSKQGTLAAQGQQLQLRKLESQESRSARRQTIIFLELIVVTLAVCWMPNQ VRRIMAAAKPKHDWTKSYFRAYMILLPFSDTFFYLSSVVNPLLYNVSSQQFRSVFGQVLR CQLTLPHANQEKHLRAHVASTMDSTRSACRPLIFPASQRSSSSARANMVFLSTFHSEAKP ESKPQELSCESPEPNSERKPANPATRNGFQEHEV
Uniprot No.

Target Background

Function

Zn2+ acts as an agonist. This receptor mediates its action through G protein association, activating a phosphatidylinositol-calcium second messenger system. Its effects are primarily mediated by Gqα and G12/G13 proteins. GPR39 is involved in regulating body weight, gastrointestinal motility, hormone secretion, and cell death.

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in liver, kidney, abomasum, uterus, small intestine and colon.

Q&A

What is the molecular structure of bovine GPR39?

Bovine GPR39 is a G protein-coupled receptor encoded by a cDNA that translates to a 462 amino acid protein. The protein exhibits high sequence homology to other mammalian GPR39 proteins, positioning it within the evolutionary conserved family of Class A GPCRs. Bovine GPR39 shows particular sequence similarity to the ghrelin receptor (GHS-R), with which it shares evolutionary origins . The receptor contains the characteristic seven transmembrane domain structure typical of GPCRs, with intracellular loops that interact with G proteins to initiate downstream signaling cascades. The structure includes specific regions for zinc binding, which serves as an important activator of the receptor in physiological contexts .

What is the tissue-specific expression profile of bovine GPR39?

Real-time PCR analysis of bovine tissues has revealed that GPR39 mRNA is expressed in multiple organs with a distinct expression pattern. The highest expression levels are found in the abomasum (the fourth stomach compartment in bovines), suggesting a significant role in digestive function. Additional expression is detected in the liver, kidney, various segments of the intestinal tract (small intestine, colon, rectum), and reproductive tissues such as the uterus . This expression profile aligns with findings in other mammalian species and supports the proposed roles of GPR39 in gastrointestinal motility, metabolic regulation, and potentially reproductive functions. The tissue distribution pattern provides a foundation for designing tissue-specific functional studies.

How is the expression of bovine GPR39 regulated at the transcriptional level?

Transcriptional regulation of bovine GPR39 involves a promoter region located within the -2.3 kb 5'-upstream region of the gene. Functional studies using human colon carcinoma-derived CACO-2 cells have demonstrated significant promoter activity within this region, indicating the presence of important regulatory elements that control GPR39 expression . The promoter appears to contain binding sites for transcription factors that may respond to metabolic, hormonal, or inflammatory signals, although the specific transcription factors involved in bovine GPR39 regulation have not been fully characterized. Understanding these regulatory mechanisms is essential for designing experiments to manipulate GPR39 expression in bovine cell and tissue models.

What signaling pathways are activated by bovine GPR39?

Bovine GPR39, like its human and rodent counterparts, activates multiple G protein-dependent signaling pathways. Upon activation, GPR39 couples to various G proteins to initiate distinct downstream cascades:

  • Gαs pathway: Stimulates adenylyl cyclase, leading to increased intracellular cAMP levels

  • Gαq pathway: Activates phospholipase C (PLC), resulting in IP1 accumulation and calcium mobilization

  • Gα12/13 pathway: Triggers serum response factor (SRF)/serum response element (SRE) dependent transcription

Additionally, GPR39 activation can induce β-arrestin recruitment, although this appears to be ligand-dependent and may not be the primary mechanism for receptor desensitization . These diverse signaling capabilities allow GPR39 to exert pleiotropic effects in different cellular contexts and may explain its involvement in numerous physiological processes ranging from metabolism to neuroprotection.

How does zinc function as an activator of bovine GPR39?

Zinc (Zn²⁺) serves as a physiological agonist for GPR39, with changes in extracellular zinc concentration capable of modulating receptor activity. The zinc-sensing mechanism involves specific binding sites on the extracellular domains of GPR39, which undergo conformational changes upon zinc binding to initiate downstream signaling cascades . This zinc sensitivity explains GPR39's role in tissues where zinc fluctuations occur, such as the gastrointestinal tract and specific brain regions. Importantly, zinc can also potentiate the effects of other GPR39 ligands, suggesting an allosteric regulatory mechanism. In experimental settings, researchers should carefully control zinc concentrations in buffers and media, as even small variations might affect receptor activity and experimental outcomes.

What are the phenotypic consequences of GPR39 deficiency in animal models?

Studies in GPR39 knockout mice have revealed multiple phenotypic alterations that provide insights into the receptor's physiological roles. These phenotypes include:

  • Depression-like behaviors in behavioral tests, suggesting involvement in mood regulation

  • Altered gastrointestinal motility and secretion, confirming roles in digestive function

  • Changes in body weight and fat composition, indicating metabolic functions

  • Impaired wound healing processes

  • Altered bone density and structure

  • Increased susceptibility to excitotoxicity in neuronal tissues

  • Dysregulated inflammatory responses in vascular tissues

These findings from knockout models help predict potential physiological roles of bovine GPR39, although species-specific differences should be considered when extrapolating to bovine systems. The multisystem effects observed in knockout models highlight the importance of tissue-specific conditional knockout approaches for more precise functional characterization.

What are the optimal methods for cloning and expressing recombinant bovine GPR39?

For successful cloning and expression of recombinant bovine GPR39, the following methodological approach is recommended:

  • cDNA synthesis: Extract total RNA from bovine abomasal tissue (where GPR39 is highly expressed), followed by reverse transcription using oligo(dT) primers to generate cDNA.

  • PCR amplification: Design primers based on the bovine GPR39 sequence (GenBank accession numbers available in literature) with appropriate restriction enzyme sites for subsequent cloning. Use high-fidelity DNA polymerase to minimize errors.

  • Expression vector selection: For mammalian expression, vectors with strong promoters (CMV, EF1α) are recommended. For protein production, consider vectors with epitope tags (His, FLAG) for purification and detection.

  • Expression systems:

    • HEK293T cells have been successfully used for GPR39 expression and functional studies

    • For large-scale production, consider stable cell lines or baculovirus-insect cell systems

    • Special consideration: GPR39 is a membrane protein, so expression levels may be limited by membrane capacity

  • Verification strategies:

    • Sequencing to confirm correct insertion without mutations

    • Western blotting using GPR39-specific antibodies

    • Functional assays to confirm receptor activity (cAMP accumulation, calcium mobilization)

The choice of expression system should be guided by the intended application, with mammalian cells preferred for functional studies and insect cells or bacterial systems optimized for structural studies or antibody production.

What strategies can be employed to study ligand binding properties of recombinant bovine GPR39?

To characterize ligand binding properties of recombinant bovine GPR39, several complementary approaches should be considered:

  • Radioligand binding assays:

    • Using monoiodinated ligands (e.g., monoiodoobestatin) with careful consideration of iodination effects on ligand bioactivity

    • Saturation binding experiments to determine affinity (Kd) and receptor density (Bmax)

    • Competition binding studies to assess relative affinities of different ligands

    • Consider that up to four iodine molecules can incorporate into obestatin during iodination, potentially affecting binding properties

  • Fluorescence-based binding assays:

    • FRET or BRET-based approaches using fluorescently labeled ligands

    • Advantages include real-time monitoring and avoiding radioactivity

  • Functional readouts as indirect binding measurements:

    • cAMP accumulation assays

    • Calcium mobilization assays

    • Serum response element (SRE) reporter assays

    • ERK1/2 phosphorylation

  • Control experiments:

    • Include GPR39-negative cells as controls

    • Test species variations of the same ligand (e.g., human, bovine, and rodent variants)

    • Assess effects of post-translational modifications (e.g., amidation)

Each approach has advantages and limitations, and combining multiple methods provides the most comprehensive characterization of receptor-ligand interactions.

How can recombinant bovine GPR39 be used to screen for novel ligands or modulators?

Developing a robust screening platform for novel GPR39 ligands requires carefully designed assay systems that can detect various aspects of receptor activation. A comprehensive screening strategy should include:

  • Primary screening assays:

    • cAMP accumulation assays using cells stably expressing bovine GPR39

    • Calcium mobilization assays with fluorescent indicators

    • β-arrestin recruitment assays

    • Receptor internalization assays

  • Secondary confirmation assays:

    • Direct binding assays with putative hits

    • Downstream signaling validation (ERK phosphorylation, SRE activation)

    • Evaluation of allosteric modulation with zinc co-application

    • Selectivity testing against related receptors (e.g., ghrelin receptor)

  • Advanced characterization:

    • Bias analysis to determine pathway-selective activation

    • Kinetic evaluation of response duration

    • Analysis of receptor desensitization and internalization

    • Assessment of zinc-dependence versus intrinsic activity

  • Consideration of structure-activity relationships:

    • Testing structural analogs of identified hits

    • Evaluating the importance of C-terminal amidation (known to affect obestatin activity)

    • Assessing effects of peptide length and core sequence elements

This multi-tiered approach allows for comprehensive identification and characterization of compounds that modulate GPR39 activity, whether as direct agonists, antagonists, or allosteric modulators.

How can single nucleotide polymorphisms (SNPs) in bovine GPR39 affect receptor function?

Analysis of SNPs in GPR39 provides valuable insights into structure-function relationships and potential physiological variations. Human GPR39 studies have identified functional SNPs that can guide investigations in bovine GPR39:

  • Known functional SNPs in human GPR39:

    • SNP rs2241764 (C149T): Changes alanine (A50) to valine (V50) in the first transmembrane region

    • SNP rs4684677 (A308T): Changes glutamine (Q15) to leucine (L15) in the mature peptide of obestatin

  • Functional consequences of SNPs:

    • Altered binding affinity for ligands

    • Modified coupling efficiency to G proteins

    • Changes in receptor expression level or localization

    • Different responses to zinc modulation

  • Methodological approaches for bovine SNP identification and characterization:

    • Genome-wide association studies in cattle populations

    • Targeted sequencing of the bovine GPR39 gene in diverse breeds

    • Site-directed mutagenesis to introduce specific SNPs into recombinant bovine GPR39

    • Functional comparative studies between wild-type and SNP variants

Understanding the functional impact of bovine GPR39 SNPs could have implications for breeding programs and veterinary medicine, particularly if these genetic variations correlate with metabolic efficiency, growth rates, or disease susceptibility in cattle.

What is the role of bovine GPR39 in gastrointestinal physiology and how can it be studied?

Bovine GPR39's high expression in the abomasum and intestinal tract suggests important roles in gastrointestinal function. To investigate these roles, researchers can employ the following approaches:

  • Ex vivo tissue studies:

    • Organ bath experiments with bovine gastrointestinal segments

    • Measurement of smooth muscle contractility in response to GPR39 modulators

    • Analysis of secretory functions in isolated mucosal preparations

  • Cell-specific investigations:

    • Primary cultures of bovine gastrointestinal cell types (epithelial cells, enteroendocrine cells)

    • Immunohistochemical localization of GPR39 in different cell types

    • Co-localization with other relevant receptors or signaling molecules

    • Single-cell RNA sequencing for cell-type specific expression patterns

  • Functional readouts:

    • Gastric acid secretion

    • Gastrointestinal motility

    • Hormone secretion from enteroendocrine cells

    • Epithelial barrier function

    • Response to inflammatory challenges

  • In vivo approaches:

    • Surgical models with cannulated bovine abomasum

    • Administration of GPR39 modulators and monitoring of physiological parameters

    • Correlation of GPR39 expression with gastrointestinal disorders in cattle

This multifaceted approach can elucidate GPR39's role in bovine digestive physiology, with potential applications in understanding and treating gastrointestinal disorders in cattle.

How does zinc modulation of bovine GPR39 contribute to metabolic regulation?

The zinc-sensing properties of GPR39 connect metal ion homeostasis with metabolic regulation, presenting a unique angle for investigating bovine metabolic physiology:

  • Tissue-specific zinc-GPR39 interactions:

    • Liver: Role in glucose metabolism and lipid handling

    • Pancreas: Potential effects on insulin secretion

    • Adipose tissue: Contribution to adipocyte function and differentiation

    • Muscle: Involvement in glucose uptake and protein synthesis

  • Metabolic pathways impacted by GPR39 activation:

    • AMPK signaling for energy sensing

    • mTOR pathway for protein synthesis

    • Insulin signaling cascade

    • Lipid oxidation and synthesis pathways

  • Experimental approaches:

    • Primary bovine hepatocytes or adipocytes treated with zinc and GPR39 modulators

    • Metabolic flux analysis using isotope-labeled substrates

    • Protein phosphorylation analysis of key metabolic enzymes

    • Gene expression profiling of metabolic pathway components

    • Zinc chelation studies to assess dependency of metabolic effects on zinc-GPR39 interaction

  • Physiological relevance:

    • Correlation with zinc status in cattle

    • Relationship to feeding state and energy balance

    • Association with metabolic disorders like ketosis or fatty liver

This research area holds particular promise for understanding how trace mineral nutrition influences metabolic health in cattle, with potential applications in optimizing feeding strategies for dairy and beef production.

How can researchers address the controversies regarding obestatin as a GPR39 ligand?

The relationship between obestatin and GPR39 has been controversial, with contradictory findings in the literature. To address these contradictions, researchers should consider:

  • Sources of experimental variability:

    • Iodination techniques: Up to four iodine molecules can incorporate into obestatin during iodination, potentially affecting binding properties and bioactivity

    • Purity of peptide preparations: Commercial sources versus in-house synthesis

    • Post-translational modifications: Amidation status of the C-terminus significantly affects activity

    • Species differences in obestatin and GPR39 sequences

  • Methodological approaches to resolve contradictions:

    • Direct comparison of monoiodinated versus polyiodinated obestatin

    • Parallel testing in multiple cell systems expressing recombinant GPR39

    • Evaluation across multiple downstream signaling pathways

    • Use of GPR39 knockout controls to confirm specificity

    • Assessment of zinc dependency of observed effects

  • Alternative explanations:

    • Potential for context-dependent signaling

    • Involvement of additional co-receptors or accessory proteins

    • Allosteric effects of zinc or other metal ions

    • Technical artifacts in binding assays

By systematically addressing these variables, researchers can help resolve the controversies surrounding obestatin-GPR39 interactions in bovine and other systems.

What are the challenges in developing specific antibodies against bovine GPR39?

Developing specific antibodies against GPR39 presents several technical challenges that researchers should consider:

  • Inherent challenges with GPCR antibodies:

    • Limited extracellular domains for antibody targeting

    • High conservation across species leading to cross-reactivity

    • Conformational epitopes that may be lost in denatured preparations

    • Low expression levels in native tissues

  • Strategic approaches:

    • Target unique extracellular loops or N-terminal regions of bovine GPR39

    • Develop peptide-based immunogens representing specific epitopes

    • Consider genetic immunization approaches with bovine GPR39 DNA

    • Screen antibody specificity using GPR39 knockout tissues as negative controls

    • Validate using multiple techniques (Western blot, immunoprecipitation, immunohistochemistry)

  • Validation criteria:

    • Absence of signal in GPR39 knockout or siRNA-treated samples

    • Correlation between antibody signal and mRNA expression patterns

    • Appropriate subcellular localization in immunostaining

    • Expected molecular weight bands in Western blots

    • Antibody performance across different applications

How can researchers differentiate between direct GPR39 effects and zinc-mediated effects in experimental systems?

The dual nature of GPR39 as both a zinc sensor and a receptor for potential peptide ligands creates challenges in experimental interpretation. To differentiate direct receptor effects from zinc-mediated effects:

  • Experimental design considerations:

    • Careful control of zinc concentrations in all buffers and media

    • Use of zinc chelators (TPEN, EDTA) with appropriate controls

    • Comparison of wild-type GPR39 with zinc-binding site mutants

    • Parallel testing with zinc-independent synthetic GPR39 agonists

  • Genetic approaches:

    • GPR39 knockout or knockdown models as negative controls

    • Site-directed mutagenesis of zinc-binding residues

    • Expression of zinc-insensitive GPR39 mutants

  • Signaling pathway analysis:

    • Compare pathways activated by zinc versus other putative ligands

    • Assess temporal patterns of activation

    • Evaluate concentration-response relationships

    • Investigate potential for pathway-selective (biased) signaling

  • Pharmacological tools:

    • Use of allosteric modulators that enhance or inhibit specific aspects of GPR39 signaling

    • Comparison of responses to different synthetic ligands with varied zinc-dependency profiles

By implementing these strategies, researchers can better differentiate direct GPR39-mediated effects from those caused by zinc through other mechanisms, leading to more precise understanding of the receptor's physiological roles.

What are the potential applications of recombinant bovine GPR39 in agricultural and veterinary research?

Recombinant bovine GPR39 offers several promising applications in agricultural and veterinary research:

  • Nutritional optimization:

    • Understanding how trace mineral nutrition (particularly zinc) affects metabolic efficiency

    • Development of feeding strategies that optimize GPR39 signaling

    • Investigation of GPR39's role in feed efficiency and nutrient utilization

  • Gastrointestinal health:

    • Exploration of GPR39 modulators for treating bovine gastrointestinal disorders

    • Investigation of GPR39's role in abomasal ulcers and displacement

    • Understanding GPR39's contribution to gut barrier function and microbiome interactions

  • Metabolic disorder prevention:

    • Elucidation of GPR39's role in transition cow disorders

    • Investigation of links to ketosis, fatty liver, and metabolic syndrome

    • Development of biomarkers based on GPR39 function or polymorphisms

  • Reproductive efficiency:

    • Characterization of GPR39 function in bovine reproductive tissues

    • Investigation of potential links to fertility and reproductive disorders

    • Exploration of zinc-GPR39 signaling in embryo development

These applications could lead to improved animal health, productivity, and welfare in the cattle industry, with particular relevance to dairy production systems where metabolic and gastrointestinal disorders represent significant economic and welfare challenges.

How might comparative studies between bovine and human GPR39 advance translational research?

Comparative studies between bovine and human GPR39 can provide valuable insights for both veterinary and human medicine:

  • Evolutionary conservation analysis:

    • Identification of highly conserved domains likely critical for function

    • Characterization of species-specific variations that may relate to physiological differences

    • Understanding of selective pressures that have shaped GPR39 evolution

  • Cross-species pharmacology:

    • Testing human GPR39 modulators on bovine GPR39

    • Identification of species-specific pharmacological profiles

    • Development of compounds with veterinary applications based on human drug discovery efforts

  • Disease model development:

    • Validation of cattle as potential models for human metabolic or gastrointestinal disorders

    • Investigation of naturally occurring GPR39 mutations in cattle and their phenotypic consequences

    • Comparative analysis of GPR39-related pathologies across species

  • Technological advancements:

    • Development of antibodies and tools with cross-species reactivity

    • Creation of assay systems applicable to both human and veterinary research

    • Shared methodologies for functional characterization

Such comparative approaches can accelerate progress in both fields, leveraging discoveries in one species to inform research in the other, while respecting the important physiological differences between ruminants and monogastric mammals.

What emerging technologies could enhance our understanding of bovine GPR39 function?

Several cutting-edge technologies offer promising approaches to advance our understanding of bovine GPR39:

  • CRISPR-Cas9 gene editing:

    • Generation of bovine cell lines with GPR39 modifications

    • Introduction of reporter tags for live imaging

    • Creation of zinc-binding site mutants

    • Development of conditional knockout systems

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify GPR39-expressing cell populations

    • Single-cell proteomics to characterize receptor expression levels

    • Patch-clamp electrophysiology to assess GPR39 effects on membrane potential

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize receptor clustering and trafficking

    • FRET/BRET sensors to monitor GPR39 activation in real-time

    • Intravital microscopy for in vivo receptor dynamics

  • Computational approaches:

    • Molecular dynamics simulations of bovine GPR39 structure

    • Systems biology modeling of GPR39 signaling networks

    • Machine learning approaches to predict ligand-receptor interactions

    • Virtual screening for novel GPR39 modulators

  • Organoid and ex vivo systems:

    • Bovine gastrointestinal organoids for functional studies

    • Microfluidic systems to study cell-cell communication

    • Ex vivo tissue slice cultures maintaining tissue architecture

These emerging technologies, applied individually or in combination, have the potential to significantly advance our understanding of bovine GPR39 biology and develop novel applications in both basic research and applied agricultural sciences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.