Recombinant Bovine G-protein coupled receptor 84 (GPR84)

Shipped with Ice Packs
In Stock

Description

Evolutionary Conservation and Variation

GPR84 has been present in vertebrates for more than 500 million years, highlighting its fundamental biological importance . Interestingly, evolutionary analyses reveal that while GPR84 is conserved across most mammalian species, it is notably absent in birds and exists as a pseudogene in bats . This pattern suggests that GPR84 function, while important, may be dispensable or compensated by alternative mechanisms in certain evolutionary lineages.

Comparative analyses of GPR84 orthologs have identified evidence of positive selection in certain mammalian lineages, particularly bears . This selective pressure indicates adaptation to specific environmental challenges, possibly related to diet, habitat, or immune system requirements. The evolutionary plasticity of GPR84 suggests that bovine GPR84 may possess species-specific adaptations relevant to ruminant physiology and immunity.

Expression Pattern and Regulation

GPR84 expression is predominantly observed in immune cells of myeloid lineage, including bone marrow, lung, and peripheral blood leukocytes . Unlike many constitutively expressed receptors, GPR84 expression is significantly upregulated under inflammatory conditions in response to stimuli such as lipopolysaccharide (LPS) and TNFα . This inducible expression pattern suggests a specialized role for GPR84 in inflammatory responses rather than homeostatic functions.

In pathological contexts, GPR84 expression is markedly increased in inflamed tissues, as demonstrated in colonic mucosa of ulcerative colitis patients and experimental colitis models . The infiltrating GPR84-positive macrophages in these inflamed tissues highlight the receptor's involvement in immune cell recruitment and activation during inflammatory processes .

Expression Systems and Methods

Recombinant protein technology has revolutionized the study of membrane proteins like GPR84 by enabling their production in controlled expression systems. For recombinant bovine GPR84, multiple expression platforms are utilized, each offering distinct advantages for specific applications :

  1. Mammalian cell systems: HEK293 cells provide a native-like environment for proper folding and post-translational modifications of bovine GPR84, critical for maintaining functional integrity .

  2. Yeast expression systems: Offer a balance between proper eukaryotic protein processing and higher yields compared to mammalian systems .

  3. E. coli expression: Enables cost-effective production of larger quantities, though potentially with limitations in post-translational modifications .

  4. In vitro cell-free systems: Allow rapid production without cellular constraints, which can be advantageous for difficult-to-express proteins .

Research on human GPR84 has employed Sf9 insect cells using the Bac-to-Bac baculovirus expression system, specifically for GPR84-Gαi1 fusion proteins used in functional assays . Similar approaches likely apply to recombinant bovine GPR84 production for specific research applications.

Purification and Characterization

Purification of recombinant bovine GPR84 typically employs affinity chromatography using various tags such as His, GST, or Fc, depending on the specific research requirements . These tags facilitate selective purification while potentially enabling specific orientation for downstream applications like crystallography or binding studies.

Functional characterization of recombinant bovine GPR84 likely employs methods similar to those used for other mammalian orthologs, including:

  1. GTPγS binding assays: To detect Gαi pathway activation, measuring the incorporation of [35S]GTPγS as an indicator of receptor activation .

  2. cAMP inhibition assays: To assess the receptor's ability to couple to Gαi and inhibit adenylyl cyclase, resulting in reduced intracellular cAMP levels .

  3. Phosphoinositide accumulation assays: Used with G protein chimeras like Gqi5 to detect Gαi signaling as intracellular PI accumulation .

Ligand Binding Properties

Bovine GPR84, like other mammalian orthologs, functions as a receptor for medium-chain fatty acids. The ligand binding profile of GPR84 shows distinct preferences for:

  1. Hydroxylated medium-chain fatty acids: 2-OH-C10, 3-OH-C10, 2-OH-C12, and 3-OH-C12 activate human GPR84 with varying potencies .

  2. Bacterial quorum sensing molecules: cis-2-decenoic acid (cis-2-C10) and trans-2-decenoic acid (trans-2-C10) serve as potent agonists of mammalian GPR84 orthologs .

  3. Synthetic agonists: Compounds like 6-n-octylaminouracil (6-OAU) activate GPR84 and can be used as pharmacological tools to study receptor function .

The receptor's ability to recognize bacterial-derived molecules suggests a role in detecting microbial metabolites, which would be particularly relevant in bovine gut health and immune responses to the ruminant microbiota.

Table 1: Activation Parameters of Human GPR84 by Medium-Chain Fatty Acids

LigandEC50 Value (μM)Assay Type
2-hydroxy capric acid (2-OH-C10)31[35S]GTPγS binding
3-hydroxy capric acid (3-OH-C10)230[35S]GTPγS binding
2-hydroxy lauric acid (2-OH-C12)9.9[35S]GTPγS binding
3-hydroxy lauric acid (3-OH-C12)13[35S]GTPγS binding
Lauric acid (C12)No activation[35S]GTPγS binding

Data derived from studies on human GPR84

Signaling Pathways and Biological Responses

Recombinant bovine GPR84 likely couples primarily to Gαi/o proteins, leading to inhibition of adenylyl cyclase and reduction in intracellular cAMP levels . This signaling pathway initiates a cascade of proinflammatory responses in immune cells, including:

  1. Enhanced chemotaxis: GPR84 activation stimulates the migration of polymorphonuclear leukocytes (PMNs) and macrophages to sites of inflammation .

  2. Amplified cytokine production: GPR84 activation enhances LPS-stimulated production of proinflammatory cytokines, including IL-8 from PMNs and TNFα from macrophages .

  3. NLRP3 inflammasome activation: In colonic macrophages, GPR84 activation enhances NLRP3 inflammasome activation, contributing to intestinal inflammation .

These proinflammatory effects position GPR84 as a critical mediator of immune responses, particularly in the context of detecting bacterial products and amplifying inflammatory cascades. In bovine physiology, these functions may be especially relevant to immune responses in the gut, udder, and respiratory tract.

Sequence Homology and Variation

Studies of GPR84 orthologs from diverse mammalian species have provided insights into both conserved elements and species-specific variations. While specific information about bovine GPR84 sequence conservation is limited in the available data, patterns observed across mammalian GPR84 orthologs suggest differential evolutionary pressures across species .

Functional studies of 17 mammalian GPR84 orthologs, representing most mammalian orders, revealed variations in expression levels, basal activity, and ligand responses . These differences likely reflect adaptations to specific environmental challenges and immune requirements faced by each species.

Table 2: Comparative Expression Levels of Selected Mammalian GPR84 Orthologs

SpeciesRelative Cell Surface ExpressionBasal Activity
HumanReference levelReference level
Rat3-4 fold higherSimilar to human
Polar Bear3-4 fold higherSignificantly lower
Panda3-4 fold higherSignificantly lower
Minke WhaleLowerSignificantly lower
OpossumLowerSignificantly lower

Data derived from heterologous expression studies in CHO-K1 cells

Functional Conservation and Divergence

  1. Basal activity: All 17 mammalian GPR84 orthologs tested exhibited constitutive activity, but with significant variations in magnitude .

  2. Ligand potency: Compared to human GPR84, the agonists C10 and 3-OH-C10 activated opossum and African elephant GPR84 with significantly higher EC50 values, indicating lower potency .

  3. Cell surface expression: When expressed in heterologous systems, mammalian GPR84 orthologs showed up to 4-fold differences in cell surface localization .

These functional differences suggest that while the core role of GPR84 in inflammatory responses is maintained across species, fine-tuning of receptor properties has occurred during mammalian evolution to optimize responses to species-specific challenges.

Evolutionary Significance

The evolutionary trajectory of GPR84 provides important context for understanding bovine GPR84 function. The receptor's presence across vertebrates for over 500 million years, combined with its absence in birds and pseudogenization in bats, indicates a complex pattern of selective pressures .

Evidence for positive selection of GPR84 in bear species suggests adaptation to specific environmental or dietary factors . For bovine GPR84, evolutionary adaptation may reflect the unique challenges of ruminant physiology, particularly the specialized digestive system harboring a complex microbiota producing various fatty acids and bacterial metabolites.

The ability of GPR84 to recognize bacterial quorum sensing molecules further supports its role in host-microbe interactions , which would be particularly relevant in bovine gut health and immunity given the importance of rumen microbiota in cattle digestion and health.

Basic Research Applications

Recombinant bovine GPR84 serves as an essential tool for understanding fundamental aspects of bovine immunology and inflammatory processes:

  1. Structural studies: Purified recombinant protein enables detailed investigation of receptor architecture through techniques such as X-ray crystallography or cryo-electron microscopy.

  2. Ligand screening: The recombinant receptor facilitates identification of natural and synthetic compounds that modulate GPR84 activity, particularly those relevant to bovine-specific pathways.

  3. Signaling pathway mapping: Studies using recombinant bovine GPR84 can elucidate the specific G proteins, adaptor molecules, and effectors involved in bovine-specific immune signaling networks.

Table 3: Recombinant GPR84 Production Methods and Research Applications

Expression SystemAvailable TagsPrimary Research Applications
Mammalian Cells (HEK293)His, GST, Fc, Non-taggedStructural studies, Functional assays
YeastHis, GST, Fc, Non-taggedLigand screening, Protein-protein interactions
E. coliHis, GST, Fc, Non-taggedAntibody production, Structural fragments
In Vitro Cell Free SystemHis, GST, Fc, Non-taggedRapid screening, Difficult constructs
Sf9 Insect CellsGPR84-Gαi1 fusionGTPγS binding assays, G protein coupling

Information compiled from available production platforms

Pharmaceutical Development

The proinflammatory role of GPR84 positions it as a potential target for therapeutic intervention in inflammatory conditions. For bovine applications, this creates opportunities for veterinary pharmaceutical development:

  1. Antagonist development: GPR84 antagonists could potentially treat inflammatory conditions in cattle, similar to how the antagonist CLH536 suppresses colitis by reducing proinflammatory macrophage function in experimental models .

  2. Drug screening platforms: Recombinant bovine GPR84 provides a specific target for screening compound libraries to identify molecules that selectively modulate receptor activity in bovine cells.

  3. Species-specific therapeutics: Differences between bovine GPR84 and human orthologs could enable development of veterinary-specific compounds with reduced potential for off-target effects in humans, enhancing safety profiles for agricultural applications.

Diagnostic and Monitoring Applications

Recombinant bovine GPR84 enables the development of diagnostic tools for veterinary medicine:

  1. Antibody production: The recombinant protein serves as an antigen for generating specific antibodies that can detect GPR84 expression in bovine tissues, potentially serving as inflammatory markers.

  2. Bioassay development: Functional assays based on recombinant bovine GPR84 could assess immune cell activation states in bovine samples, providing diagnostic information about inflammatory status in conditions like mastitis or metritis.

  3. Pathogen interaction studies: The receptor's ability to recognize bacterial metabolites suggests potential applications in monitoring microbiome-host interactions relevant to bovine health and productivity.

Table 4: Functional Responses of GPR84 Activation in Immune Cells

Cell TypeGPR84 Activation ResponseDisease Relevance
Polymorphonuclear LeukocytesChemotaxis, Enhanced IL-8 productionAcute inflammation
MacrophagesChemotaxis, Enhanced TNFα productionChronic inflammation
Colonic MacrophagesNLRP3 inflammasome activation, M1 polarizationIntestinal inflammation

Data compiled from functional studies of GPR84 activation

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request as best as possible.
Lead Time
Delivery times may vary based on your purchasing method and location. We kindly request that you consult your local distributors for specific delivery estimates.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Please note: The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GPR84; G-protein coupled receptor 84
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MWNASDVNFSCYHESVLGYRYVAVSWGIVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIA NLTVADLLYCTLLQPFSVDTYLHLHWRTGATFCQIFGFLLFVSNSVSILTLCLIALGRYL LIAHPKLFPQVFSAKGIVLALVSTWVVAVASFAPLWPIYILVPVVCTCSFDRIRGQPYTT ILMGIYFVVGLSSVGVFYCLIHQQVKRAAQAMNQYKLRQASIRSNHVAGAHEAVPGRFQE LDSGLASGGPSEGISSEPVSAATTQTLEGDSSEVRDQSNSKAAKQMAEKNPPGVAAKART TKGAQRAQDSPSEFGKVTRMCFAVFLCFTLSYIPFLLLNILDAKVQAPRVVHMLAANLTW LNGCINPVLYAAMNRQFRQAYGSLLRRGPQSFHRFH
Uniprot No.

Target Background

Function
G-protein coupled receptor 84 (GPR84) is a receptor for medium-chain free fatty acids (FFAs) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. It is not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acids is coupled to a pertussis toxin sensitive G(i/o) protein pathway. GPR84 may play important roles in processes ranging from fatty acid metabolism to the regulation of the immune system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is GPR84 and what are its primary functions?

GPR84 is a G-protein coupled receptor belonging to the GPCR 1 family. It functions primarily as an enhancer of inflammatory signaling in macrophages once inflammation is established . This receptor contains seven transmembrane domains and is expressed in multiple tissues including bone marrow, brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta, intestine, lung, and peripheral blood leukocytes .

GPR84 plays a significant role in modulating inflammatory responses, particularly in macrophages. When activated, GPR84 enhances the expression and secretion of pro-inflammatory mediators such as TNFα, IL-6, and CCL2, contributing to the inflammatory cascade . Its expression is dramatically upregulated in response to inflammatory stimuli, particularly through signaling via multiple Toll-like receptors (TLRs) .

In addition to its inflammatory functions, GPR84 has been identified as essential for the taste of medium chain saturated fatty acids, suggesting a role in sensory perception .

How does bovine GPR84 compare structurally to human and murine GPR84?

While specific structural comparisons of bovine GPR84 to human and murine homologs aren't detailed in the provided search results, we can infer some information based on general GPCR conservation patterns. The human GPR84 contains 396 amino acids according to the antibody information , and the protein shows predicted reactivity across multiple species including rat, dog, cow, sheep, horse, and monkey .

The high predicted cross-reactivity suggests significant sequence conservation across mammalian species. Most GPCRs maintain highly conserved transmembrane domains while displaying greater variability in the N-terminal extracellular domain and C-terminal intracellular domain. This conservation pattern likely applies to bovine GPR84 as well, with the greatest sequence homology expected in the membrane-spanning regions responsible for ligand binding and G-protein coupling.

For experimental applications, this conservation has implications for cross-species antibody reactivity and the translational relevance of findings between bovine, murine, and human systems.

What are the known natural and synthetic ligands for GPR84?

Based on the available research data, GPR84 responds to medium-chain fatty acids as natural ligands. The synthetic agonist 6-OAU (6-octylaminouracil) has been demonstrated to effectively activate GPR84 . In experimental settings, 6-OAU at a concentration of 1 μM has been shown to significantly enhance the expression of pro-inflammatory mediators in LPS-primed macrophages .

Medium-chain saturated fatty acids appear to be particularly important natural ligands, as evidenced by GPR84's essential role in the taste perception of these compounds . The receptor's affinity for medium-chain fatty acids aligns with its increased expression during metabolic dysfunctions such as hyperglycemia and hypercholesterolemia .

It's worth noting that when designing experiments with recombinant bovine GPR84, both natural medium-chain fatty acids and synthetic agonists like 6-OAU should be considered for receptor activation studies, with the understanding that species-specific differences in ligand affinity may exist.

How is GPR84 expression regulated during inflammatory responses?

GPR84 expression is dramatically upregulated during inflammatory conditions. In experimental models of endotoxemia, LPS injection (1 mg/kg) significantly increased Gpr84 mRNA levels in mouse adipose tissue, bone marrow, brain, lung, kidney, and intestine compared to control mice, with the highest expression observed in bone marrow . This upregulation was evident at both 2 and 8 hours post-LPS administration .

At the cellular level, GPR84 is particularly upregulated in monocytes during inflammation. Cell sorting experiments revealed that monocytes, but not neutrophils or other myeloid cells, significantly increased Gpr84 mRNA expression in the bone marrow of LPS-treated mice .

In macrophage populations, GPR84 expression is significantly increased in response to pro-inflammatory "M1-like" polarization but remains at basal levels during "M2-like" anti-inflammatory polarization. Stimulation with LPS dramatically upregulates Gpr84 in various macrophage populations including bone marrow-derived macrophages (BMDMs), biogel-elicited macrophages, resident peritoneal macrophages, RAW 264.7 cells, microglia, and human monocyte-derived macrophages (hMDMs) . In contrast, stimulation with IL-4, which promotes M2 polarization, does not increase Gpr84 expression and may actually downregulate it .

Multiple pathogen-associated molecular patterns can induce GPR84 expression, with both LPS and zymosan causing significant increases that peak at approximately 8 hours post-stimulation .

What tissue distribution patterns does GPR84 exhibit in healthy versus diseased states?

During acute inflammation, such as in experimental endotoxemia models, GPR84 expression increases significantly across multiple tissues. The fold-increase in mRNA levels following LPS administration is particularly notable in:

TissueFold Increase at 2hFold Increase at 8h
Bone Marrow~25-fold~35-fold
Brain~12-fold~15-fold
Lung~10-fold~12-fold
Adipose Tissue~8-fold~10-fold
KidneyNot measured at 2h~8-fold
IntestineNot measured at 2h~15-fold

(Note: These values are approximated from the data trends shown in Figure 1 of reference )

In atherosclerosis models, ApoE-/- mice fed a high-fat diet showed significantly increased aortic Gpr84 expression compared to those on a chow diet at both 6 and 12 weeks . Similarly, human monocyte-derived macrophages exposed to oxidized LDL (oxLDL) for 48 hours showed significantly increased GPR84 expression .

What factors influence the expression levels of GPR84 in bovine tissues?

While the search results don't specifically address bovine GPR84 expression, we can extrapolate from other mammalian models. Several key factors likely influence GPR84 expression in bovine tissues:

For researchers working with bovine GPR84, these factors should be carefully controlled or monitored to ensure reproducible experimental results.

What are the most reliable methods for detecting bovine GPR84 expression?

Based on the research data available, several methods have proven reliable for detecting GPR84 expression, though each has specific considerations for bovine applications:

  • Quantitative PCR (qPCR): This appears to be the most widely used method for detecting GPR84 expression at the mRNA level. For bovine applications, researchers should design primers specific to the bovine GPR84 sequence. The TaqMan® approach has been successfully used for mouse GPR84 detection (assay ID Mm02620530_s1) , and similar commercially available assays may be available for bovine GPR84. When performing qPCR, normalization to appropriate housekeeping genes like GAPDH is essential: ΔCT(GPR84) = CT(GPR84) - CT(GAPDH) .

  • Western Blotting: For protein-level detection, Western blotting using specific anti-GPR84 antibodies can be employed. The search results indicate availability of a polyclonal antibody (bs-13507R) that shows reactivity with mouse GPR84 and predicted reactivity with several other species including cow . This antibody is recommended for use at dilutions of 1:300-5000 for Western blot applications .

  • ELISA: The same polyclonal antibody mentioned above is also suitable for ELISA detection at dilutions of 1:500-1000 .

It's important to note that the lack of commercially available specific antibodies against GPR84 has been a limitation in some studies . The antibody information provided indicates that the antibody (bs-13507R) is derived from a KLH-conjugated synthetic peptide from human GPR84, specifically from the region spanning amino acids 1-100 of the 396-amino acid protein . For bovine applications, validation of cross-reactivity would be recommended.

When working with recombinant bovine GPR84, expression can be confirmed using these methods, with qPCR providing information on transcript levels and Western blotting or ELISA confirming protein expression.

What are the optimal conditions for expressing and purifying recombinant bovine GPR84?

  • Expression Systems: For recombinant GPCR production, several expression systems can be considered:

    • Mammalian cell lines (HEK293, CHO): These often provide the most native-like post-translational modifications and membrane insertion but at lower yields.

    • Insect cells (Sf9, Hi5): These offer a compromise between yield and proper folding.

    • Yeast (Pichia pastoris): This can provide higher yields but may have differences in glycosylation patterns.

    • E. coli: This typically offers high yield but challenges with membrane insertion and post-translational modifications.

    For bovine GPR84, a mammalian or insect cell expression system would likely provide the most functionally relevant protein.

  • Construct Design: When designing expression constructs for bovine GPR84:

    • Consider adding affinity tags (His, FLAG, etc.) for purification

    • Include a cleavable signal peptide to enhance membrane insertion

    • For structural studies, thermostabilizing mutations or fusion partners (e.g., T4 lysozyme) may be beneficial

    • Codon optimization for the expression host can improve yields

  • Solubilization and Purification: As a membrane protein, GPR84 requires detergent solubilization. Common detergents include DDM, LMNG, or digitonin. For purification, affinity chromatography (based on the chosen tag) followed by size exclusion chromatography is typically employed.

  • Functional Validation: Purified recombinant bovine GPR84 should be validated for proper folding and function using:

    • Ligand binding assays with known GPR84 agonists like 6-OAU

    • G-protein coupling assays

    • Thermal stability assessments

It's important to note that GPR84 has been described as difficult to work with due to antibody limitations , suggesting potential challenges in expression and detection that researchers should anticipate.

What cell-based assays are most effective for studying bovine GPR84 function?

Based on the research methodologies described in the search results, several cell-based assays would be effective for studying bovine GPR84 function:

  • Pro-inflammatory Mediator Production Assays: GPR84 activation enhances the expression and secretion of pro-inflammatory cytokines and chemokines. Researchers have successfully measured:

    • mRNA expression of TNFα, IL-6, and CCL2 by qPCR following GPR84 activation

    • Protein secretion of these mediators by ELISA

    This approach involves:

    • Priming cells with LPS (0.1 μg/ml for 2 hours)

    • Stimulating with a GPR84 agonist (e.g., 6-OAU at 1 μM)

    • Measuring responses at multiple time points (30, 60, 90, 120, and 240 minutes)

  • Calcium Imaging: This technique has been used to study GPR84 function in taste perception . For GPR84 signaling studies:

    • Load cells with calcium-sensitive dyes

    • Stimulate with GPR84 agonists

    • Analyze the area under the curve (AUC) from the resulting calcium transients

    • Use appropriate Tyrode's buffer (containing in mM: 140 NaCl, 5 KCl, 1 CaCl2, 1 MgCl2, 10 HEPES, 10 glucose, and 10 Na pyruvate; pH 7.40)

  • Macrophage Polarization Assays: Given GPR84's differential expression in M1 vs. M2 macrophages , assays examining how GPR84 activation affects polarization markers would be valuable.

  • Knockout/Knockdown Validation: Using GPR84-/- cells as negative controls or GPR84 knockdown approaches can validate the specificity of observed responses .

For bovine-specific applications, these assays would need to be adapted using:

  • Bovine macrophages (e.g., bovine alveolar macrophages or bone marrow-derived macrophages)

  • Appropriate culture conditions for bovine cells

  • Bovine-specific cytokine detection reagents for ELISAs

  • Primers designed for bovine GPR84 and cytokine genes for qPCR

The statistical analysis approach used in published research includes Student's unpaired t-test or one-way analysis of variance (ANOVA) followed by Dunnett's multiple comparison post hoc test, with P < 0.05 considered statistically significant .

How does GPR84 signaling interact with other inflammatory pathways?

GPR84 functions as an enhancer of inflammatory signaling in macrophages, interacting with multiple inflammatory pathways in complex ways:

  • TLR Pathway Integration: GPR84 activation appears to synergize with TLR signaling. In research models, macrophages are typically primed with LPS (activating TLR4) before GPR84 agonist treatment to observe enhanced inflammatory responses . This suggests that GPR84 may amplify ongoing inflammatory responses rather than initiating them independently.

  • Pro-inflammatory Cytokine Enhancement: When activated in LPS-primed macrophages, GPR84 rapidly enhances both gene expression and protein secretion of key inflammatory mediators:

    Inflammatory MediatormRNA Peak TimeProtein Secretion Peak Time
    TNFαRapid increase4 hours post-activation
    IL-6Rapid increase1 hour post-activation
    CCL2Rapid increase4 hours post-activation

    This temporal pattern suggests that GPR84 may differentially regulate various inflammatory mediators .

  • IL-4 Regulation: In activated T cells, GPR84 has been reported to regulate early interleukin-4 (IL-4) gene expression , suggesting involvement in T cell polarization and adaptive immune responses.

  • Metabolic Inflammation Cross-talk: GPR84 expression is enhanced under hyperglycemic and hypercholesterolemic conditions , indicating a potential role in metabolic inflammation. This suggests cross-talk between metabolic sensing and inflammatory signaling pathways, with GPR84 potentially serving as an integrator of these signals.

  • Macrophage Polarization Influence: GPR84 is highly expressed in M1-like pro-inflammatory macrophages but not in M2-like pro-resolution macrophages . This differential expression pattern suggests that GPR84 may help maintain the pro-inflammatory phenotype of macrophages.

For researchers studying bovine inflammatory responses, understanding these pathway interactions is crucial for interpreting experimental results and designing targeted interventions.

What are the key considerations for developing GPR84 antagonists for therapeutic applications?

Development of GPR84 antagonists represents a promising therapeutic approach, particularly for inflammatory conditions. Key considerations include:

  • Target Validation:

    • GPR84's role as an enhancer of inflammatory signaling in macrophages makes it a potential target for anti-inflammatory therapeutics

    • Its increased expression in hyperglycemic and hypercholesterolemic conditions suggests potential applications in metabolic disorders

    • The specific contribution of GPR84 to inflammatory pathology should be validated in disease-specific models

  • Structure-Activity Relationship Development:

    • Known GPR84 agonists like 6-OAU provide starting points for antagonist development

    • Medium-chain fatty acids as natural ligands offer structural insights for competitive antagonist design

    • Species differences in the ligand-binding domain should be considered when developing antagonists for human applications based on bovine or murine studies

  • Assay Systems for Screening:

    • Cell-based assays measuring inhibition of GPR84-mediated enhancement of TNFα, IL-6, and CCL2 production

    • Calcium imaging to assess inhibition of GPR84-mediated calcium signaling

    • Competitive binding assays with labeled known ligands

    • Thermal shift assays to confirm direct binding to the receptor

  • Selectivity Profiling:

    • Cross-screening against other fatty acid receptors

    • Evaluation of effects on other GPCRs to minimize off-target effects

    • Assessment of species selectivity if developing therapeutics for veterinary applications

  • Pharmacokinetic and Pharmacodynamic Considerations:

    • GPR84's membrane localization suggests antagonists will need appropriate lipophilicity for membrane access

    • Tissue distribution of GPR84, particularly in bone marrow, brain, and inflamed tissues , has implications for drug distribution requirements

    • The rapid enhancement of cytokine production following GPR84 activation (within hours) suggests a need for sustained target engagement

  • Therapeutic Context:

    • Determining whether GPR84 antagonism would be most effective as a monotherapy or as an adjunct to existing anti-inflammatory approaches

    • Identifying specific disease states (e.g., atherosclerosis, diabetes complications, acute inflammatory conditions) where GPR84 antagonism would provide maximum benefit

A methodical approach addressing these considerations would optimize the development of GPR84 antagonists as potential therapeutics for inflammatory and metabolic disorders.

How can GPR84 knockout models be effectively utilized to study its function?

GPR84 knockout models provide powerful tools for understanding this receptor's function in various physiological and pathological contexts. Based on the search results and general principles of knockout model utilization, the following approaches are recommended:

  • Generation and Validation of Knockout Models:

    • The GPR84 knockout model described in the search results was generated by replacing the GPR84 gene with a LacZ/Neo cassette by homologous recombination

    • Validation should include:

      • Genotyping to confirm knockout status

      • qPCR verification of absence of GPR84 mRNA

      • Western blot confirmation of protein absence (if suitable antibodies are available)

      • Functional assays to confirm loss of GPR84-mediated responses

  • Comparative Analysis Approaches:

    • Side-by-Side Comparison: Direct comparison of wild-type and GPR84-/- cells or animals in response to stimuli

    • Rescue Experiments: Reintroduction of GPR84 into knockout cells to confirm phenotype specificity

    • Age-Matched Controls: Use of littermate controls to minimize genetic background effects

  • Specific Experimental Applications:

    • Inflammatory Challenge Models: Exposing GPR84-/- and wild-type animals to LPS or other inflammatory stimuli to assess differences in cytokine production and inflammatory resolution

    • Metabolic Challenge Studies: Subjecting knockout animals to high-fat diet or hyperglycemic conditions to evaluate GPR84's role in metabolic inflammation

    • Taste Perception Analysis: Using calcium imaging and behavioral studies to assess responses to medium-chain fatty acids, leveraging GPR84's role in taste perception

  • Cell-Specific Analysis:

    • Macrophage Function Studies: Isolating bone marrow-derived macrophages from GPR84-/- mice to study changes in polarization, cytokine production, and response to stimuli

    • Cross with Reporter Lines: Breeding GPR84-/- mice with lines expressing fluorescent markers in specific cell populations (e.g., GFP-PLCβ2 and GFP-GAD67 lines mentioned in the literature) to study cell-specific effects

  • Data Analysis Considerations:

    • Statistical comparison between knockout and wild-type conditions using Student's unpaired t-test or ANOVA with appropriate post-hoc tests

    • Analysis of area under the curve (AUC) for temporal responses

    • Consideration of potential compensatory mechanisms that may develop in knockout models

  • Experimental Design Guidelines:

    • Utilize adult (2-6 month) animals for consistency with published protocols

    • Maintain animals with water and normal chow ad libitum in a room with 12-h:12-h day/night cycle as standard conditions

    • Ensure all procedures comply with institutional animal care guidelines

By systematically applying these approaches, researchers can effectively leverage GPR84 knockout models to elucidate this receptor's function in various physiological and pathological contexts.

What is the role of GPR84 in metabolic disorders and potential therapeutic implications?

Research indicates that GPR84 plays a significant role in metabolic disorders, particularly at the intersection of metabolism and inflammation:

  • Diabetic Conditions:

    • GPR84 mRNA expression is significantly upregulated in bone marrow, brain, and kidney of diabetic NOD mice compared to non-diabetic controls

    • In vitro, BMDMs exposed to high glucose conditions (25 mM D-glucose) show significantly increased GPR84 expression compared to those in low glucose (5.5 mM) conditions

    • The response is specific to metabolically active D-glucose, as L-glucose does not induce similar upregulation

  • Dyslipidemia and Atherosclerosis:

    • ApoE-/- mice (a model of atherosclerosis) fed a high-fat diet show significantly increased aortic GPR84 expression compared to those on a chow diet at both 6 and 12 weeks

    • Human monocyte-derived macrophages exposed to oxidized LDL (oxLDL) for 48 hours show significantly increased GPR84 expression

    • This suggests GPR84 may contribute to foam cell formation and atherosclerotic plaque development

  • Mechanism of Involvement:

    • GPR84 likely serves as a bridge between metabolic stress and inflammatory activation

    • Its upregulation during metabolic stress may enhance macrophage inflammatory responses to subsequent stimuli

    • Medium-chain fatty acids, which are natural ligands for GPR84, may be elevated during certain metabolic conditions, providing increased activation signals

  • Therapeutic Implications:

    • Anti-inflammatory Approach: GPR84 antagonists could potentially reduce metabolic inflammation without broadly suppressing immune function

    • Macrophage Phenotype Modulation: Targeting GPR84 might shift macrophage polarization from pro-inflammatory M1 to anti-inflammatory M2 in metabolic tissues

    • Tissue-Specific Targeting: The differential upregulation of GPR84 in specific tissues during diabetes (bone marrow, brain, kidney) suggests potential for targeted therapeutic approaches

  • Research Gaps and Future Directions:

    • The precise signaling mechanisms linking GPR84 activation to metabolic inflammation require further elucidation

    • The relative contribution of GPR84 to metabolic disease progression compared to other inflammatory pathways needs quantification

    • The potential for GPR84-targeted therapies to improve insulin sensitivity, reduce atherosclerosis, or ameliorate diabetic complications remains to be fully explored

These findings suggest that GPR84 may be a valuable therapeutic target for the treatment of metabolic disorders, particularly those with a significant inflammatory component.

How can species differences in GPR84 function impact translational research?

Species differences in GPR84 function can significantly impact translational research in several important ways:

Recognizing and accounting for these species differences is crucial for researchers working with bovine GPR84 who aim to generate findings with translational relevance to human health and disease.

What are the most promising techniques for studying GPR84-ligand interactions?

Understanding GPR84-ligand interactions is critical for both basic research and drug development. Based on the available research and general approaches in GPCR pharmacology, the following techniques are most promising:

  • Computational Approaches:

    • Homology Modeling: Creating structural models of bovine GPR84 based on crystal structures of related GPCRs

    • Molecular Docking: Predicting binding modes of known ligands like medium-chain fatty acids and 6-OAU

    • Molecular Dynamics Simulations: Exploring the dynamic interactions between GPR84 and its ligands over time

    • Pharmacophore Modeling: Identifying key structural features required for GPR84 activation or inhibition

  • Binding Assays:

    • Radioligand Binding: Using radiolabeled ligands to measure direct binding to GPR84

    • Fluorescence-Based Binding: Employing fluorescent ligands and techniques like fluorescence polarization or FRET

    • Surface Plasmon Resonance: Measuring real-time binding kinetics of ligands to immobilized recombinant GPR84

    • Thermal Shift Assays: Assessing ligand-induced stabilization of the receptor

  • Functional Readouts:

    • Calcium Imaging: Measuring intracellular calcium responses following GPR84 activation, as described in the taste receptor studies

    • cAMP Assays: Quantifying changes in cAMP levels in response to GPR84 ligands

    • β-Arrestin Recruitment: Monitoring β-arrestin recruitment as a measure of receptor activation

    • MAPK Phosphorylation: Assessing activation of downstream MAPK pathways following GPR84 stimulation

  • Structural Biology Techniques:

    • Cryo-EM: Determining the structure of GPR84 in different conformational states

    • X-ray Crystallography: If crystals can be obtained, providing high-resolution structural information

    • HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry): Identifying regions of conformational change upon ligand binding

    • Site-Directed Mutagenesis: Systematically mutating potential ligand-binding residues to map the binding pocket

  • Advanced Cellular Techniques:

    • BRET (Bioluminescence Resonance Energy Transfer): Measuring ligand-induced conformational changes and protein-protein interactions

    • FRET (Fluorescence Resonance Energy Transfer): Similar to BRET but using fluorescent proteins

    • Label-Free Technologies: Measuring whole-cell responses to GPR84 activation without artificial labels

    • Single-Cell Analysis: Examining heterogeneity in GPR84 responses across cell populations

  • Innovative Approaches:

    • Nanobodies: Using camelid antibody fragments to stabilize specific receptor conformations

    • Biosensors: Developing genetically encoded sensors that report on GPR84 activation status

    • Native Mass Spectrometry: Analyzing GPR84-ligand complexes in near-native conditions

    • Covalent Labeling: Using specially designed ligands that form covalent bonds with the receptor to trap specific states

For researchers studying bovine GPR84, a multifaceted approach combining computational methods with appropriate binding and functional assays would provide the most comprehensive understanding of ligand interactions and guide the development of species-specific modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.