Recombinant Bovine Gamma-secretase subunit PEN-2 (PSENEN)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will prepare the product according to your demand.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
PSENEN; PEN2; Gamma-secretase subunit PEN-2; Presenilin enhancer protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFIVPAYTEQSQIKGYVWRS AVGFFLWVIVLSTWITIFQIYRPRWGALGDYLSFTIPLGTP
Uniprot No.

Target Background

Function
PEN-2 (PSENEN) is an essential subunit of the gamma-secretase complex. This complex is an endoprotease that catalyzes the intramembrane cleavage of integral membrane proteins, including Notch receptors and APP (amyloid-beta precursor protein). The gamma-secretase complex plays a crucial role in Notch and Wnt signaling cascades. It regulates downstream processes by processing key regulatory proteins and controlling cytosolic CTNNB1 levels. PSENEN modulates both endoproteolysis of presenilin and gamma-secretase activity.
Gene References Into Functions
  1. The PSENEN gene exhibits down-regulation in bovine intramuscular fibroblast cells during differentiation into adipocytes. PMID: 19592191
Database Links
Protein Families
PEN-2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus, Golgi stack membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Q&A

What is PEN-2 and what is its fundamental role in the gamma-secretase complex?

PEN-2 (PSENEN) is an essential regulatory component of the gamma-secretase complex, a multiprotein protease critical for intramembrane cleavage of various substrates including amyloid precursor protein (APP) and Notch receptors. As a stabilizing subunit, PEN-2 interacts with presenilin (PSEN1/PSEN2), nicastrin, and APH-1 to maintain γ-secretase activity, directly influencing the production of amyloid-β (Aβ) peptides implicated in Alzheimer's disease pathogenesis . The importance of PEN-2 has been conclusively demonstrated through knockout studies, where PEN-2−/− embryos display profound Notch-deficiency phenotypes and embryonic lethality, confirming its essential role in the γ-secretase complex . Recent evidence suggests that PEN-2 is more than just a structural component and may actively contribute to the catalytic mechanism of the enzyme .

What is the structural organization of PEN-2 protein?

PEN-2 is a 101-amino acid protein with two hydrophobic domains arranged in a hairpin topology, with the loop domain exposed to the intracellular side of the cell membrane . The protein's structural features are critical to its function, with specific domains playing distinct roles in complex assembly and activity. The conserved amino acid sequence motif DYSLF in the C-terminus of PEN-2 is crucial for both the assembly of the γ-secretase complex and the stabilization of presenilin fragments after endoproteolysis . Additionally, the N-terminal part of hydrophobic domain 1 interacts with the TMD4 of presenilin 1 (PS1) and is important for PS endoproteolysis, highlighting the structural basis for PEN-2's functional role in activating the γ-secretase complex .

What experimental models are used to study PEN-2 function in research settings?

Researchers employ various experimental models to investigate PEN-2 function, ranging from cellular to animal models. PEN-2−/− fibroblasts derived from E9.5 embryos provide a valuable system for structure-function studies . These fibroblasts can be immortalized using the large T-antigen and cultured in standard conditions with Dulbecco's modified Eagle's medium/F-12 containing 10% fetal bovine serum . For protein expression studies, retroviral transduction systems using pMSCVpuro vectors containing wild-type or mutant PEN-2 allow for stable expression in PEN-2−/− fibroblasts, with transduced cells selected using puromycin (5 μg/ml) . Site-directed mutagenesis techniques, such as the XL site-directed mutagenesis kit, enable the generation of specific PEN-2 mutations for functional analysis . Additionally, whole-mount in situ hybridization with probes for downstream Notch targets like Hes-5 and Delta-like1 can assess Notch signaling disruption in PEN-2−/− embryos .

How can researchers effectively analyze PEN-2 interactions with other gamma-secretase components?

Analysis of PEN-2 interactions with other gamma-secretase components requires sophisticated biochemical and imaging techniques. Co-immunoprecipitation assays using anti-PEN-2 antibodies can effectively pull down interaction partners, with comparative strength of associations assessed by parallel immunoprecipitations . For instance, NotchΔE has been shown to associate more strongly with PEN-2 than with PS1, as demonstrated by greater pull-down efficiency with anti-PEN-2 antibodies compared to anti-PS1C antibodies . Masked cryo-EM image classification combined with signal subtraction represents an advanced approach that allows visualization of structural changes in PEN-2 and its effects on other components like TM6 of PS1 . This technique has revealed that PEN-2 binding to the complex activates the active site and has an allosteric effect on TM6, providing insight into the mechanism of gamma-secretase activation . The scanning cysteine accessibility method can be employed to investigate the structure-function relationship of PEN-2, revealing important residues like glycine 22 and proline 27 in hydrophobic domain 1 that are essential for complex formation and stability .

How does PEN-2 contribute to Alzheimer's disease pathology and what are the therapeutic implications?

PEN-2 significantly influences Alzheimer's disease pathology through its role in regulating gamma-secretase activity and consequently Aβ production. The incorporation of modifications like a FLAG tag at the N-terminus of PEN-2 has been shown to change the conformation of presenilin, resulting in an increased Aβ42/Aβ40 ratio similar to what is observed with familial Alzheimer's disease mutations in presenilin . This finding suggests that PEN-2 can modulate the processing of APP in ways that affect the generation of pathogenic Aβ species. Importantly, gamma-secretase modulators that decrease Aβ42 production have been found to bind mainly to PEN-2, highlighting this subunit as a potential therapeutic target . The development of selective gamma-secretase modulators (GSMs) and Notch-sparing inhibitors that target PEN-2 remains an active area of investigation for Alzheimer's disease treatment . Recent studies are particularly focused on understanding PEN-2's regulatory role in modulating the Aβ42/Aβ40 ratio, which represents a key therapeutic strategy against amyloidosis .

What are the current challenges in developing PEN-2-targeted therapeutics for neurological disorders?

Developing PEN-2-targeted therapeutics for neurological disorders faces several significant challenges. The primary difficulty stems from the gamma-secretase complex's pleiotropic roles in processing numerous physiologically important substrates beyond APP, particularly Notch receptors . This substrate promiscuity creates a narrow therapeutic window, as demonstrated by previous clinical trials of gamma-secretase inhibitors that were discontinued due to Notch-related adverse effects . Another challenge is understanding the complex allosteric mechanisms through which PEN-2 influences gamma-secretase activity. While it's established that PEN-2 binding activates the active site and has an allosteric effect on TM6 of presenilin, the complete mechanistic details remain elusive . The dynamic conformational states of PEN-2 within the complex further complicate drug design efforts. Cryo-EM studies have revealed that PEN-2 can adopt different conformations that correlate with changes in the active site geometry, particularly the distance between the catalytic aspartates . These conformational variations need to be considered in structure-based drug design approaches.

How does PEN-2 influence Notch signaling and what are the implications for development?

PEN-2 plays a crucial role in regulating Notch signaling, with profound implications for developmental processes. The essential nature of this role is dramatically demonstrated in PEN-2−/− embryos, which display a severe Notch-deficiency phenotype similar to that observed in PS1−/−PS2−/− embryos, reflecting a lack of γ-secretase activity and the consequent effects on Notch signaling pathways . Molecular analysis of these embryos reveals the absence of Hes-5 mRNA and ectopic expression of Delta-like 1 mRNA compared to wild-type embryos, confirming the disruption of Notch signaling . The developmental consequences of this disruption are profound, with PEN-2−/− embryos showing embryonic lethality by E11 . This lethality highlights the essential nature of PEN-2-dependent Notch processing in early embryonic development. At the molecular level, PEN-2 is required for activation of Notch signaling pathways through its role in facilitating gamma-secretase-mediated cleavage of Notch receptors . This cleavage releases the Notch intracellular domain, which then translocates to the nucleus to regulate gene expression patterns critical for cell fate decisions during development.

How can researchers distinguish between Notch-dependent and Notch-independent effects of PEN-2 manipulation?

Distinguishing between Notch-dependent and Notch-independent effects of PEN-2 manipulation requires careful experimental design and multiple complementary approaches. One effective strategy is to conduct parallel experiments with Notch signaling inhibitors or in Notch-deficient systems to determine which effects of PEN-2 manipulation persist independently of Notch activity . Molecular analysis of Notch target gene expression using techniques such as RT-PCR, RNA sequencing, or in situ hybridization for genes like Hes-5 and Delta-like1 can directly assess the impact on Notch signaling pathways . Researchers can also employ rescue experiments, where constitutively active Notch intracellular domain (NICD) is expressed in PEN-2-deficient systems to determine which phenotypes can be reversed by Notch activation alone . For cellular studies, comparative analysis of multiple gamma-secretase substrates can reveal differential effects that might indicate Notch-independent functions. For example, examining the processing of APP, Notch, and other substrates like N-cadherin or ErbB4 following PEN-2 manipulation can identify substrate-selective effects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.