Recombinant Bovine Gap junction alpha-5 protein (GJA5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate them in your order, and we will prepare the product according to your demand.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to settle the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-359
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
GJA5
Target Protein Sequence
GDWSFLGEFLEEVHKHSTVIGKVWLTVLFIFRMLVLGTAAESSWGDEQADFLCDTMQPGC ENVCYDQAFPISHIRYWVLQVIFVSTPSLVYLGHAVHMVRVQEKRKLLREAERAKEARAA GSYEYPVAEKTELSCWEEVNGRIALQGSLLNTYVCSILIRTTMEVAFIVGQYLLYGVFLD TLHVCRRSPCPHPVNCYVSRPTEKNVFIVFMLAVAGLSLFLSLAELYHLGWKKIRQRYVK SQPGVGECQLPGPSAGRVQSCTPPPDFNQCLENGPGGKFFSPFSNKMASQQNTDNLSTEQ VRSQEQIQREGFIHIRYAQKPEVPNEGSPGPSLPHGYQSDKRRLSKASSKARSDDLSV
Uniprot No.

Target Background

Function
Gap junctions are formed by clusters of closely packed pairs of transmembrane channels known as connexons. These connexons facilitate the diffusion of low molecular weight materials between neighboring cells.
Database Links
Protein Families
Connexin family, Alpha-type (group II) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is GJA5 and what is its primary function in cellular communication?

GJA5 (Gap Junction Protein Alpha-5), also known as Connexin-40 (Cx40), is a gap junction protein that forms transmembrane channels allowing the diffusion of low molecular weight materials between adjacent cells. One gap junction consists of a cluster of closely packed pairs of transmembrane channels called connexons, through which materials diffuse from one cell to a neighboring cell . GJA5 is particularly important in cardiac tissues, where it mediates the coordinated electrical activation of the atria . GJA5 is selectively expressed in atrial myocytes and forms hexameric hemichannels (connexons) that dock with connexons from adjacent cells to create intercellular channels. These channels facilitate direct intercellular communication and are crucial for the synchronized contraction of cardiac tissue and proper electrical conduction.

What are the structural characteristics of bovine GJA5 compared to human GJA5?

Bovine GJA5 shares significant sequence homology with human GJA5, particularly in the transmembrane and extracellular domains. The human GJA5 protein has 358 amino acids with a predicted molecular weight of approximately 40 kDa . The C-terminal region (amino acids 229-358) contains regulatory sites that affect channel function and protein-protein interactions . While specific bovine GJA5 structural details are not explicitly mentioned in the provided search results, research has shown that connexin proteins are generally well-conserved across mammalian species, with differences primarily in the cytoplasmic loop and carboxyl-terminal regions. These regions are involved in regulation of channel gating, protein trafficking, and interactions with other cellular proteins. When working with recombinant bovine GJA5, researchers should consider these potential species-specific differences in post-translational modifications and protein interactions that might affect experimental outcomes.

How can I verify the identity and purity of recombinant bovine GJA5 protein?

To verify the identity and purity of recombinant bovine GJA5 protein, a multi-method approach is recommended:

  • Western Blot Analysis: Use a validated anti-GJA5 antibody to confirm the presence of the protein at the expected molecular weight (approximately 40 kDa) . Multiple antibodies targeting different epitopes can provide more robust verification.

  • Mass Spectrometry: Perform peptide mass fingerprinting to confirm the amino acid sequence matches bovine GJA5.

  • SDS-PAGE: Assess protein purity through SDS-PAGE with Coomassie or silver staining. A single band at the expected molecular weight indicates high purity .

  • Functional Assays: Assess gap junction formation capacity through dye transfer studies similar to those used for evaluating human GJA5 function .

  • Immunofluorescence: When expressed in cell culture, recombinant GJA5 should localize to cell-cell junctions and form visible gap junction plaques that can be detected by immunostaining .

Comparing results with positive controls (such as commercially available GJA5 standards) and negative controls will enhance verification reliability.

What are the optimal expression systems for producing functional recombinant bovine GJA5?

The optimal expression systems for producing functional recombinant bovine GJA5 depend on the experimental requirements:

  • Mammalian Expression Systems: HEK-293T cells have been successfully used for expressing connexin proteins including human GJA5 . These systems provide proper post-translational modifications and protein folding essential for functional studies. N2A cells (neuroblastoma cell line) have also been used effectively for functional studies of connexin proteins .

  • Insect Cell Expression: Baculovirus-infected insect cells can yield higher protein quantities while maintaining most post-translational modifications.

  • Cell-Free Systems: For structural studies requiring large amounts of protein, cell-free systems may be used, though functionality may be compromised.

For functional studies, mammalian expression systems are preferred as they provide the cellular machinery needed for proper protein trafficking and assembly into functional gap junctions. When designing expression constructs, consider including purification tags (His, FLAG, etc.) positioned to avoid interference with protein function. When testing functionality, dye transfer assays using gap junction-permeable tracers like Lucifer Yellow can confirm the formation of functional channels .

What are the most reliable methods for studying GJA5 trafficking and assembly into gap junctions?

The most reliable methods for studying GJA5 trafficking and assembly into gap junctions include:

  • Immunofluorescence Confocal Microscopy: This technique allows visualization of GJA5 localization within cells. Wild-type GJA5 should form visible gap junction plaques at cell-cell interfaces, while trafficking-defective mutants may show retention in intracellular compartments . Time-lapse imaging can track the movement of fluorescently-tagged GJA5 from synthesis to membrane insertion.

  • Co-localization Studies: Double-labeling with markers for cellular compartments (ER, Golgi, plasma membrane) helps identify trafficking bottlenecks.

  • FRAP (Fluorescence Recovery After Photobleaching): This technique measures the dynamic exchange of connexin proteins within gap junction plaques.

  • Surface Biotinylation Assays: These can quantify the proportion of GJA5 that reaches the cell surface.

  • Electron Microscopy: Provides ultra-structural details of gap junction formation.

Research has shown that mutations in GJA5 can impair intracellular transport, as demonstrated in studies of human GJA5 variants associated with atrial fibrillation . For example, cells expressing GJA5 with the p.Pro265Ser mutation form sparse or no visible gap-junction plaques in regions of cell-cell contact compared to wild-type GJA5 .

How can I quantitatively assess the functional properties of GJA5 gap junction channels?

Quantitative assessment of GJA5 gap junction channel function can be performed using several complementary approaches:

  • Dye Transfer Assays: Inject gap junction-permeable fluorescent dyes like Lucifer Yellow into one cell and measure the rate of dye spread to adjacent cells. Quantify dye transfer efficiency by measuring fluorescence intensity over time in recipient cells . For example, studies have shown that wild-type human GJA5 allows dye to diffuse between cells reaching equilibration in approximately 13-15 minutes, while mutant forms may show reduced transfer rates .

  • Dual Whole-Cell Patch Clamp: This electrophysiological technique directly measures electrical coupling between cell pairs expressing GJA5. It provides precise quantification of junctional conductance and channel gating properties.

  • Microinjection Studies: Similar to dye transfer but can use different molecular weight tracers to assess channel selectivity.

  • FRAP Analysis: Measures gap junction communication by photobleaching one cell and monitoring fluorescence recovery via gap junctions.

  • Scrape-Loading Assays: A population-based approach for assessing gap junction communication in cell monolayers.

Data should be analyzed using appropriate statistical methods to compare wild-type and mutant/modified GJA5 function. In previous studies, cells expressing mutant GJA5-p.Pro265Ser showed approximately 50% reduction in dye transfer rate compared to wild-type (1.3×10⁵ vs. 2.9×10⁵ dye molecules per second) .

What experimental controls are essential when working with recombinant bovine GJA5?

When working with recombinant bovine GJA5, the following controls are essential:

Positive Controls:

  • Human GJA5 with well-documented function and localization patterns

  • Other connexin proteins with known trafficking and assembly characteristics

  • Cell lines known to express endogenous GJA5 (e.g., atrial myocytes)

Negative Controls:

  • Gap junction-deficient cell lines (like N2A cells) without GJA5 transfection

  • GJA5 constructs with known trafficking or functional defects

  • Treatment with gap junction blockers (e.g., carbenoxolone, heptanol)

Specificity Controls:

  • Antibody validation using knockout/knockdown systems

  • Multiple antibodies targeting different GJA5 epitopes

  • Pre-absorption controls for immunostaining

Technical Controls:

  • Transfection efficiency monitoring

  • Cell viability assessment

  • Expression level normalization

Experimental Design Controls:

  • Time-course experiments to track protein expression and trafficking

  • Dose-response relationships for functional studies

  • Replicate experiments under identical conditions

For example, when studying dye transfer, results should be normalized to account for differences in dye loading between cells, and the rate of fluorescence increment in injected cells should be compared between mutant and wild-type experimental groups .

How do specific mutations in GJA5 affect protein function and what methodologies can detect these effects?

Specific mutations in GJA5 can affect protein function in several ways, and various methodologies can detect these effects:

Effects of GJA5 Mutations:

  • Impaired Trafficking: Mutations can cause retention in intracellular compartments rather than localization to gap junction plaques. For example, immunofluorescence studies have shown that the p.Pro265Ser variant results in sparse or no visible gap junction plaques at cell-cell contacts .

  • Reduced Intercellular Coupling: Mutations may allow normal trafficking but impair channel function. Dye transfer studies with Lucifer Yellow have demonstrated that p.Pro265Ser mutation reduces intercellular coupling by approximately 50% compared to wild-type GJA5 .

  • Altered Channel Properties: Some mutations change selectivity or conductance properties rather than completely eliminating function. Electrophysiological studies have shown that different mutations can have varying effects on junctional conductance.

  • Dominant Negative Effects: Heterozygous mutations may interfere with wild-type protein function.

Methodologies to Detect Effects:

  • Immunofluorescence and Confocal Microscopy: Visualize protein localization and gap junction plaque formation .

  • Dye Transfer Assays: Quantify functional intercellular communication by measuring the rate of fluorescent dye transfer between adjacent cells .

  • Electrophysiological Techniques: Measure electrical coupling and channel properties using patch-clamp recordings.

  • Biochemical Assays: Assess protein expression, stability, and oligomerization.

  • Animal Models: Evaluate physiological consequences of mutations in vivo, such as using zebrafish models to examine heart tube morphology disruption caused by GJA5 mutations .

Studies have identified multiple missense mutations in human GJA5 associated with atrial fibrillation, with some mutations found to be somatic (present only in cardiac tissue) rather than germline .

What is the correlation between GJA5 mutations and cardiovascular diseases, and how can recombinant protein studies help elucidate these relationships?

GJA5 mutations have been significantly correlated with cardiovascular diseases, particularly atrial fibrillation (AF) and congenital heart defects like Tetralogy of Fallot (TOF). Recombinant protein studies provide crucial insights into the molecular mechanisms underlying these relationships:

GJA5 Mutations in Cardiovascular Disease:

  • Atrial Fibrillation: Multiple heterozygous missense mutations in GJA5 have been identified in patients with idiopathic AF. Interestingly, some of these mutations were somatic (found only in cardiac tissue) rather than germline (present in all tissues) . This suggests that tissue-specific genetic alterations can predispose to arrhythmias.

  • Tetralogy of Fallot: The heterozygous nucleotide change (c.793C>T) leading to p.Pro265Ser variant has been found in approximately 1% of non-syndromic TOF patients . Studies in zebrafish models showed that injection of the GJA5-p.Pro265Ser mutant disrupted heart tube morphology in 37% of embryos compared to 6% with wild-type GJA5 .

  • Other Congenital Heart Defects: In mice, deletion of Gja5 can cause various complex congenital heart diseases, particularly affecting the cardiac outflow tract .

How Recombinant Protein Studies Help:

  • Functional Characterization: Expressing recombinant wild-type and mutant GJA5 in cell culture systems allows direct assessment of protein function. For example, dye transfer studies have shown reduced intercellular communication with mutant proteins .

  • Structure-Function Relationships: By creating specific mutations and measuring their effects, researchers can map critical functional domains within the GJA5 protein.

  • Mechanistic Insights: Recombinant protein studies help determine whether mutations cause disease through loss-of-function, gain-of-function, or dominant-negative mechanisms.

  • Therapeutic Development: Understanding how mutations affect protein function guides the development of targeted therapeutics to restore normal gap junction communication.

  • Model Systems: Recombinant GJA5 can be used in animal models to confirm the pathogenicity of mutations and test potential interventions .

The prevalence of GJA5 mutations in cardiac diseases highlights the critical role of gap junction communication in cardiac development and function. For instance, studies found GJA5 mutations in approximately 1% of TOF patients , adding to the genetic heterogeneity of this congenital heart defect.

How can I design experiments to distinguish between trafficking defects and functional defects in GJA5 mutants?

Designing experiments to distinguish between trafficking defects and functional defects in GJA5 mutants requires a systematic approach combining imaging, biochemical, and functional techniques:

Experimental Design Strategy:

  • Subcellular Localization Studies:

    • Immunofluorescence and confocal microscopy to visualize GJA5 localization

    • Co-localization with markers for ER (e.g., calnexin), Golgi (e.g., GM130), and plasma membrane

    • Live-cell imaging with fluorescently tagged GJA5 to track trafficking dynamics

  • Biochemical Assays:

    • Surface biotinylation to quantify plasma membrane expression

    • Protease protection assays to determine membrane topology

    • Glycosylation analysis to assess processing through the secretory pathway

    • Co-immunoprecipitation to identify interactions with trafficking machinery

  • Functional Assessments:

    • Dye transfer assays using gap junction-permeable tracers (Lucifer Yellow)

    • Electrophysiological recordings to measure junctional conductance

    • FRAP analysis to assess gap junction dynamics

  • Rescue Experiments:

    • Temperature-sensitive trafficking (e.g., culturing at 30°C vs. 37°C)

    • Chemical chaperones (e.g., 4-phenylbutyrate) to rescue trafficking defects

    • Creation of chimeric constructs with wild-type domains

Decision Framework:

  • Trafficking Defect: If mutant GJA5 shows predominant intracellular retention (ER/Golgi) with minimal gap junction plaque formation at cell-cell interfaces.

  • Assembly Defect: If mutant GJA5 reaches the plasma membrane but fails to form visible gap junction plaques.

  • Functional Defect: If mutant GJA5 forms normal-appearing gap junction plaques but shows reduced dye transfer or electrical coupling.

  • Combined Defect: If mutant GJA5 shows both abnormal localization and reduced function in the channels that do form.

For example, studies of the human GJA5 p.Pro265Ser variant demonstrated both trafficking and functional defects: cells expressing this mutant formed sparse or no visible gap junction plaques and showed reduced dye transfer efficiency (9.2±2.7% vs. 18.9±3.4% relative fluorescence intensity at 13 minutes compared to wild-type) .

What approaches can be used to study the interaction of GJA5 with other connexins and regulatory proteins?

Studying the interaction of GJA5 with other connexins and regulatory proteins requires sophisticated biochemical, imaging, and functional approaches:

Protein-Protein Interaction Methods:

  • Co-immunoprecipitation (Co-IP): Precipitate GJA5 using specific antibodies and identify interacting partners through immunoblotting or mass spectrometry. This approach can detect stable interactions but may miss transient associations .

  • Proximity Ligation Assay (PLA): Detect protein interactions in situ with high sensitivity and specificity by amplifying signals from antibodies binding to proteins in close proximity.

  • FRET/BRET Analysis: Measure real-time protein interactions in living cells using fluorescence or bioluminescence resonance energy transfer between tagged proteins.

  • Cross-linking Studies: Chemically cross-link interacting proteins before isolation to capture transient interactions.

  • Yeast Two-Hybrid Screening: Identify potential interacting partners from expression libraries, though confirmation in mammalian systems is necessary.

  • GST Pull-down Assays: Use recombinant GST-tagged GJA5 domains to identify domain-specific interactions.

Functional Interaction Studies:

  • Co-expression Systems: Express GJA5 with other connexins (e.g., Cx43) to assess formation of heteromeric channels with distinct properties.

  • Dominant-Negative Approaches: Use trafficking-defective or function-defective GJA5 mutants to determine effects on wild-type protein function.

  • Pharmacological Manipulation: Use kinase/phosphatase inhibitors to assess the role of post-translational modifications in protein interactions.

  • siRNA Knockdown: Selectively reduce expression of potential interacting proteins to assess functional consequences on GJA5 trafficking or channel function.

Advanced Imaging Methods:

  • Super-Resolution Microscopy: Techniques like STORM or PALM can resolve sub-diffraction protein complexes at gap junctions.

  • Live-Cell TIRF Microscopy: Visualize dynamic interactions at the plasma membrane with high signal-to-noise ratio.

  • Correlative Light and Electron Microscopy (CLEM): Combine functional imaging with ultrastructural details.

Studies have shown that connexin proteins can form heteromeric channels with distinct properties compared to homomeric channels, and interactions with regulatory proteins can modulate gap junction assembly, stability, and function at the plasma membrane.

How can recombinant bovine GJA5 be used in high-throughput drug screening for modulators of gap junction communication?

Recombinant bovine GJA5 can be effectively employed in high-throughput drug screening to identify modulators of gap junction communication using the following approaches:

Cell-Based Screening Platforms:

  • Stable Cell Line Development:

    • Generate cell lines stably expressing bovine GJA5 with reporter systems

    • Create paired cell lines expressing wild-type and disease-associated mutants

    • Include fluorescent tags for monitoring expression and localization

  • Functional Readout Systems:

    • Fluorescent dye transfer assays adapted to microplate format

    • Calcium wave propagation measured by fluorescent calcium indicators

    • Membrane potential-sensitive dyes to detect electrical coupling

    • FRET-based sensors for detecting conformational changes

  • Automated Imaging Platforms:

    • High-content screening microscopy to simultaneously assess:

      • GJA5 expression levels

      • Subcellular localization

      • Gap junction plaque formation

      • Functional coupling between cells

Screening Strategy:

  • Primary Screen:

    • Screen compound libraries at single concentrations

    • Look for compounds that enhance trafficking of mutant GJA5 or improve functional coupling

    • Use Z' factor and signal-to-background ratio to validate assay quality

  • Secondary Validation:

    • Dose-response relationships for hit compounds

    • Orthogonal assays to confirm mechanism of action

    • Counter-screens to eliminate compounds with non-specific effects

  • Mechanistic Characterization:

    • Electrophysiological studies of identified hits

    • Biochemical analysis of effects on protein-protein interactions

    • Assessment of compound effects on post-translational modifications

Data Analysis and Hit Selection:

  • Multi-Parameter Analysis:

    • Machine learning algorithms to identify compounds affecting multiple aspects of GJA5 biology

    • Cluster analysis to group compounds with similar mechanisms

  • Structure-Activity Relationship Studies:

    • Identify structural features required for activity

    • Guide medicinal chemistry optimization

This approach could identify compounds that rescue trafficking-defective GJA5 mutants similar to those identified in patients with atrial fibrillation or congenital heart defects , potentially leading to novel therapeutic strategies for these conditions.

What are the challenges in producing and purifying membrane-spanning proteins like GJA5, and how can they be overcome?

Producing and purifying membrane-spanning proteins like GJA5 presents significant challenges due to their hydrophobic nature and complex folding requirements. Here are the key challenges and strategies to overcome them:

Challenges and Solutions:

  • Expression Challenges:

    • Challenge: Low expression levels in heterologous systems

    • Solutions:

      • Use strong inducible promoters optimized for membrane proteins

      • Screen multiple expression hosts (mammalian, insect, yeast)

      • Optimize codon usage for the expression host

      • Add fusion tags that enhance expression (e.g., SUMO, MBP)

      • Consider cell-free expression systems for toxic proteins

  • Protein Folding and Stability:

    • Challenge: Misfolding and aggregation during expression

    • Solutions:

      • Lower expression temperature to slow folding

      • Co-express molecular chaperones

      • Use detergents that mimic native membrane environment

      • Include stabilizing ligands during expression

      • Design constructs with thermostabilizing mutations

  • Extraction and Solubilization:

    • Challenge: Maintaining native conformation during extraction

    • Solutions:

      • Screen multiple detergents (mild non-ionic, zwitterionic)

      • Use lipid-detergent mixed micelles

      • Try nanodiscs or amphipols as alternatives to detergents

      • Optimize detergent:protein ratios

      • Include stabilizing additives (cholesterol, specific lipids)

  • Purification Challenges:

    • Challenge: Maintaining protein stability during purification

    • Solutions:

      • Use affinity tags positioned to avoid functional interference

      • Implement gentle elution conditions

      • Include stabilizing agents throughout purification

      • Minimize purification steps and time

      • Perform size exclusion chromatography to remove aggregates

  • Functional Assessment:

    • Challenge: Verifying that purified protein retains native function

    • Solutions:

      • Reconstitute into liposomes for functional assays

      • Assess oligomeric state by native PAGE or analytical ultracentrifugation

      • Verify proper folding by circular dichroism spectroscopy

      • Perform limited proteolysis to assess conformational integrity

Optimization Table for GJA5 Production:

ParameterOptions to TestConsiderations
Expression HostHEK293T , Insect cells, YeastMammalian hosts provide proper post-translational modifications
DetergentsDDM, LMNG, Digitonin, GDNStart with milder detergents to preserve structure
Affinity TagsHis, FLAG, STREPPosition at C-terminus to avoid interference with channel assembly
Stabilizing AdditivesCholesterol, CHS, Specific lipidsMatch lipid composition to native membrane environment
Purification MethodIMAC, Size exclusion, Ion exchangeMulti-step purification may be necessary for high purity
Storage ConditionsGlycerol %, Temperature, Buffer compositionTest stability at different temperatures and time points

By systematically addressing these challenges, researchers can improve the yield and quality of purified recombinant GJA5 for structural and functional studies.

How do the properties of bovine GJA5 compare with GJA5 from other species in experimental settings?

While the provided search results don't specifically compare bovine GJA5 with other species, we can extrapolate from general connexin biology and the available data on human GJA5 to address this question:

Cross-Species Comparison of GJA5 Properties:

  • Sequence Homology and Conservation:

    • Connexin proteins are generally well-conserved across mammalian species, particularly in transmembrane domains and extracellular loops

    • The C-terminal region (amino acids 229-358) often shows greater variability between species and contains regulatory sites affecting channel function

    • The HomoloGene tool from NCBI can be used to analyze conservation levels across species

  • Functional Properties:

    • Channel conductance and permeability may vary between species due to differences in amino acid composition

    • Regulatory mechanisms including phosphorylation sites may differ in the C-terminal domain

    • Response to pH, voltage, and calcium gating may show species-specific variations

  • Protein-Protein Interactions:

    • Interactions with other connexins and regulatory proteins may show species-specific patterns

    • Some interaction partners may be conserved while others differ between species

  • Expression Patterns:

    • Tissue-specific expression patterns of GJA5 are generally conserved across mammals, with predominant expression in atrial myocardium

    • Developmental timing of expression may vary between species

  • Antibody Cross-Reactivity:

    • Antibodies raised against human GJA5 may cross-react with bovine GJA5 depending on epitope conservation

    • Commercial antibodies often specify cross-reactivity with various species based on sequence homology

Experimental Considerations for Cross-Species Studies:

When using bovine GJA5 as a model for human disease-associated mutations, researchers should consider:

  • Creating equivalent mutations based on sequence alignment

  • Comparing trafficking and assembly in the same expression system

  • Functional testing under identical conditions

  • Validation of findings across multiple species when possible

These comparative studies can provide insights into both conserved mechanisms and species-specific adaptations in gap junction biology.

What are the best zebrafish or mouse models for studying GJA5 function, and how can recombinant protein enhance these studies?

Zebrafish and mouse models provide valuable in vivo systems for studying GJA5 function. Here's how these models can be optimized and enhanced with recombinant protein approaches:

Zebrafish Models:

  • Transgenic Reporter Lines:

    • GJA5 promoter-driven fluorescent reporters to visualize expression patterns

    • Tagged GJA5 to monitor protein localization in vivo

  • Knockdown/Knockout Approaches:

    • Morpholino oligonucleotides for transient knockdown

    • CRISPR/Cas9 gene editing for stable mutant lines

    • Evidence shows that microinjection of GJA5-p.Pro265Ser mutant disrupts heart tube morphology in 37% of zebrafish embryos compared to 6% with wild-type GJA5

  • Rescue Experiments:

    • mRNA microinjection to restore wild-type function

    • Heat-shock inducible transgenes for temporal control

  • Functional Assessments:

    • High-speed imaging of cardiac conduction

    • Calcium imaging to assess cell-cell coupling

Mouse Models:

  • Global and Conditional Knockouts:

    • Global Gja5 knockout mice display various complex congenital heart diseases

    • Tissue-specific conditional knockouts using Cre-lox technology

    • Inducible systems for temporal control of gene deletion

  • Knock-in Models:

    • Introduction of disease-associated mutations

    • Reporter knock-ins to track expression

  • Humanized Models:

    • Replacement of mouse Gja5 with human GJA5 sequence

    • Introduction of human disease mutations in the native context

  • Functional Analysis:

    • Electrocardiography to detect arrhythmias

    • Optical mapping of cardiac conduction

    • Histological analysis of gap junction distribution

Enhancing Animal Models with Recombinant Protein Approaches:

  • Structure-Function Analysis:

    • Generate recombinant proteins with specific mutations prior to in vivo testing

    • Validate antibodies and detection methods using recombinant protein

  • Rescue Strategies:

    • Use purified recombinant protein for ex vivo studies with tissue from knockout animals

    • Develop cell-penetrating peptide-conjugated GJA5 for in vivo delivery

  • Domain-Specific Functions:

    • Create chimeric proteins with domains from different species

    • Study isolated domains to understand their specific roles

  • Biomarker Development:

    • Generate antibodies against specific phosphorylated forms

    • Develop conformation-specific antibodies

  • Therapeutic Development:

    • Test peptide mimetics of functional domains

    • Screen for compounds that enhance GJA5 function using recombinant protein before testing in animal models

The combination of animal models with recombinant protein approaches provides complementary insights: animal models offer physiological context while recombinant protein studies allow precise molecular manipulation and mechanistic investigation.

What are the future directions for GJA5 research and how might recombinant bovine GJA5 contribute to these advances?

Future directions for GJA5 research span multiple scientific domains, with recombinant bovine GJA5 potentially making significant contributions to these advances:

  • Structural Biology Advances:

    • High-resolution structural determination of full-length GJA5 gap junctions

    • Cryo-EM analysis of GJA5 in different functional states

    • Structural basis for selective permeability and gating

    • Comparative structural analysis across species to identify conserved functional domains

  • Systems Biology Integration:

    • Comprehensive mapping of the GJA5 interactome in health and disease

    • Integration of gap junction function with other intercellular communication pathways

    • Network analysis of connexin-dependent cellular processes

  • Precision Medicine Applications:

    • Development of personalized treatments for GJA5-associated cardiac disorders

    • Pharmacogenomic profiling to predict responses to gap junction modulators

    • Gene therapy approaches to correct disease-causing mutations

  • Therapeutic Development:

    • High-throughput screening for compounds that enhance or restore GJA5 function

    • Development of peptide mimetics targeting specific GJA5 domains

    • Gene editing technologies for correction of disease-causing mutations

  • Advanced Imaging Technologies:

    • Super-resolution microscopy of gap junction dynamics in living tissues

    • Intravital imaging of GJA5 function in disease models

    • Label-free imaging methods for gap junction assessment

Recombinant bovine GJA5 can contribute to these advances by:

  • Providing a stable and consistent source of protein for structural studies

  • Serving as a comparative model for human GJA5 function

  • Enabling high-throughput screening platforms for drug discovery

  • Supporting the development and validation of diagnostic antibodies and assays

  • Facilitating detailed structure-function analysis of specific domains and mutations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.