Recombinant Bovine Gap junction beta-1 protein (GJB1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Bovine GJB1 is a synthetically produced version of the native gap junction protein found in cattle (Bos taurus). Gap junctions facilitate direct intercellular communication by forming channels that allow the passage of ions, metabolites, and signaling molecules (≤1 kDa) . In bovines, GJB1 is critical for:

  • Myelin sheath maintenance in Schwann cells

  • Liver homeostasis and metabolic coupling

  • Radial diffusion pathways in oligodendrocytes

Structurally, it contains four transmembrane domains and assembles into hexameric connexons, which dock with adjacent cells to form functional channels .

Production and Purification

Recombinant bovine GJB1 is typically expressed in prokaryotic or eukaryotic systems. Key methodologies include:

Table 1: Expression Systems and Characteristics

Host SystemTagsPurityMolecular MassApplications
E. coliHis, GST>97%~44 kDaImmunization, SDS-PAGE
Mammalian cellsFLAG, Myc>90%~32 kDaLocalization studies
Wheat germNative>80%~32 kDaFunctional assays

Common purification steps involve affinity chromatography (e.g., His-tag) and endotoxin removal to ensure biological activity .

Biophysical Properties

  • Trafficking Defects: Mutations in the transmembrane domains (e.g., p.L144del, p.C173Y) cause cytoplasmic retention in the Golgi apparatus, impairing channel assembly .

  • Aggregation: Overexpression of mutant GJB1 induces intracellular stress granules and reduces cell viability by 40–48% compared to wild-type .

Table 2: Functional Impact of GJB1 Mutations

MutationLocalizationGJ PermeabilityClinical Severity
Wild-typeMembrane plaquesIntactNone
p.R220Pfs*23Cytoplasmic aggregatesLostEarly onset, severe
p.F31SPartial membraneReducedModerate

Pathological Relevance

  • Charcot-Marie-Tooth Disease (CMT): Over 400 GJB1 mutations are linked to X-linked CMT1X, characterized by peripheral neuropathy due to demyelination .

  • Stress Response: Mutant GJB1 increases stress granule formation (e.g., G3BP1 markers) and disrupts Schwann cell proliferation .

Applications in Biomedical Research

  • Disease Modeling: Used to study CMT1X pathogenesis and screen therapeutic compounds targeting connexin trafficking .

  • Structural Studies: Cryo-EM and X-ray crystallography to resolve channel architecture .

  • Diagnostic Tools: Recombinant GJB1 serves as an antigen for antibody validation in ELISA and Western blot .

Challenges and Future Directions

  • Species Variability: Bovine GJB1 shares 95% homology with human orthologs, but species-specific functional differences require further study .

  • Therapeutic Strategies: Gene editing (e.g., CRISPR-Cas9) and small-molecule chaperones are being explored to rescue connexin trafficking .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJB1; CXN-32; Gap junction beta-1 protein; Connexin-32; Cx32
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
GJB1
Target Protein Sequence
MNWTGLYTLLSGVNRHSTAIGRVWLSVIFIFRIMVLVVAAESVWGDEKSSFICNTLQPGC NSVCYDHFFPISHVRLWSLQLILVSTPALLVAMHVAHQQHIEKKMLRLEGHGDPLHLEEV KRHKVHISGTLWWTYVISVVFRLLFEAAFMYVFYLLYPGYAMVRLVKCDAYPCPNTVDCF VSRPTEKTIFTVFMLAASGICIILNVAEVVYLIFRACARRAQRRSNPPSRKGSGGFGHRL SPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC
Uniprot No.

Target Background

Function
A gap junction is comprised of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low-molecular-weight materials diffuse from one cell to an adjacent cell.
Gene References Into Functions
  1. The intermediate invasive status of bovine trophoblast is supported by the co-expression of connexins (Cx)26, Cx32, and Cx43 in trophoblast giant cells. PMID: 16310041
Database Links

KEGG: bta:281194

STRING: 9913.ENSBTAP00000027331

UniGene: Bt.516

Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the molecular structure of bovine GJB1 and how does it form functional gap junctions?

Bovine GJB1 (Connexin32) is a transmembrane protein that forms hexameric structures called connexons or hemichannels. Six individual connexin proteins oligomerize to create a central pore. When two hemichannels from adjacent cells dock together, they form a complete gap junction channel that enables direct cell-to-cell communication and the passage of small molecules below 1 kDa, including ions, metabolites, and signaling molecules .

The protein structure includes four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N- and C-terminal domains. The transmembrane domains provide structural support and form the channel pore, while the extracellular loops mediate docking between hemichannels. The C-terminal domain is involved in regulation through protein interactions and post-translational modifications .

Functional gap junctions appear as plaques at cell-cell interfaces and can be visualized using immunofluorescence microscopy. Research demonstrates that both wild-type GJB1 and certain mutant forms can form visible gap junction plaques, though mutants may show differences in plaque formation efficiency .

How do mutations in different domains of bovine GJB1 affect protein function?

Mutations in different domains of GJB1 have distinct effects on protein function, trafficking, and aggregation propensity. Research on human GJB1 variants provides valuable insights applicable to bovine GJB1:

  • Transmembrane domain mutations (e.g., F31S and W44G in TM1) significantly increase protein aggregation and typically impair trafficking to the plasma membrane . These mutations are located in regions critical for channel formation and stability.

  • C-terminal domain mutations (e.g., R220Pfs*23) can lead to truncated proteins with compromised gap junction plaque formation . The C-terminus is critical for protein trafficking and regulatory interactions.

  • Mutations throughout the protein can induce cellular stress responses, with studies showing that cells expressing mutant GJB1 exhibit significantly more stress granule formation (40-48%) compared to wild-type GJB1 (24%) .

Different mutations exhibit varying degrees of cytotoxicity, with frameshift mutations like R220Pfs*23 showing greater impact on cell viability than missense mutations in transmembrane domains .

What expression systems are most effective for producing functional recombinant bovine GJB1?

The choice of expression system significantly impacts the yield, folding, and functionality of recombinant bovine GJB1:

Expression SystemAdvantagesLimitationsApplications
Mammalian cells (HeLa, HEK293)Native-like post-translational modifications; proper trafficking; formation of gap junction plaquesLower yields; higher cost; longer timeframeFunctional studies; trafficking analysis; gap junction plaque formation
Insect cells (Sf9, Hi5)Moderate yields; eukaryotic processing; scalabilityLess mammalian-like glycosylationStructural studies; protein-protein interaction studies
Bacterial systems (E. coli)High yields; low cost; rapid productionInclusion body formation; refolding required; lack of post-translational modificationsAntigen production; structural studies after refolding
Cell-free systemsRapid production; controllable environmentRequires membrane mimetics for proper foldingInitial screening; prototype production

For stable mammalian expression, G418 selection has been successfully used to select permanently transfected cells expressing GJB1 . When studying bovine GJB1 function, mammalian expression systems provide the most physiologically relevant environment despite their lower yields.

What techniques are most effective for assessing gap junction channel function of recombinant bovine GJB1?

Multiple complementary techniques should be employed to comprehensively assess gap junction channel functionality:

  • Dye Transfer Assays: Gap junction-mediated intercellular communication (GJIC) can be quantified by introducing gap junction-permeable fluorescent dyes (e.g., Lucifer Yellow, calcein-AM) into one cell and monitoring their spread to adjacent cells. This approach has been successfully used to assess GJIC in lens epithelial cells expressing GJB1 .

  • Electrophysiological Measurements: Dual whole-cell patch-clamp recordings provide direct measurements of gap junctional conductance between cell pairs expressing recombinant GJB1, offering the most quantitative assessment of channel function.

  • Immunofluorescence Microscopy: This technique visualizes the formation of gap junction plaques at cell-cell interfaces using antibodies against GJB1 or epitope tags like FLAG . While this approach confirms proper trafficking and assembly, it does not directly measure channel function.

  • Detergent Fractionation Analysis: Sequential detergent extraction can differentiate between properly assembled gap junction plaques and non-functional protein aggregates. Research has shown that mutant forms of GJB1 show increased levels in detergent-resistant fractions compared to wild-type protein .

  • Cell Viability Assessment: The CCK-8 assay has been used to evaluate potential cytotoxicity associated with GJB1 expression and aggregation . This provides indirect evidence of cellular consequences resulting from dysfunctional GJB1.

For robust assessment, researchers should implement multiple techniques to differentiate between properly trafficked but non-functional channels versus improperly trafficked protein.

How can recombinant bovine GJB1 protein aggregation be minimized during expression and purification?

Protein aggregation is a significant challenge when working with recombinant bovine GJB1. Research shows that even wild-type GJB1 forms visible aggregates when overexpressed, with mutant forms showing significantly increased aggregation . Several strategies can minimize aggregation:

  • Expression Optimization:

    • Reduce expression temperature (28-30°C) to slow protein synthesis and allow proper folding

    • Use inducible expression systems with careful titration of inducer concentration

    • Consider transient transfection rather than stable expression to minimize long-term cellular stress

  • Protein Extraction and Purification:

    • Select mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin for initial solubilization

    • Include glycerol (10-15%) and specific lipids in extraction buffers to stabilize the protein

    • Employ size-exclusion chromatography as a final purification step to remove aggregates

    • Consider amphipols or nanodiscs for the final preparation to enhance stability

  • Buffer Optimization:

    • Maintain pH in the range of 7.0-7.5 to minimize charge-based aggregation

    • Include reducing agents to prevent disulfide-mediated aggregation

    • Optimize ionic strength based on the isoelectric point of bovine GJB1

Research has shown that detergent-based sequential fractionation can effectively separate properly folded protein from aggregates, with aggregation often occurring in the endoplasmic reticulum rather than the Golgi apparatus .

What molecular factors regulate the trafficking and assembly of recombinant bovine GJB1?

Multiple molecular factors influence the trafficking and assembly of bovine GJB1:

  • Growth Factor Signaling:

    • Fibroblast Growth Factor (FGF) increases gap junction-mediated intercellular communication in lens epithelial cells in a concentration-dependent manner

    • Transforming Growth Factor Beta (TGF-β) up-regulates gap junction coupling through a mechanism distinct from FGF

    • Remarkably, simultaneous exposure to both TGF-β and FGF abolishes their individual abilities to up-regulate GJIC, despite maintained cell-cell contact

  • Kinase Activity:

    • p38 kinase plays a critical role in gap junction assembly, as inhibition of p38 kinase activity restores gap junction formation and increases intercellular dye coupling when FGF and TGF-β are co-present

    • This represents a novel type of cross-talk between FGF and TGF-β signaling pathways in the regulation of gap junction assembly

  • Post-translational Modifications:

    • Phosphorylation of specific residues affects trafficking, assembly, and turnover

    • Ubiquitination regulates protein degradation and can influence steady-state levels of assembled gap junctions

  • Protein Domain Integrity:

    • Mutations in the transmembrane domains can cause retention in the endoplasmic reticulum and increased protein aggregation

    • C-terminal domain mutations can compromise gap junction plaque formation despite trafficking to the membrane

Understanding these regulatory mechanisms is crucial for designing expression systems and experimental conditions that optimize functional recombinant bovine GJB1 production.

How can site-directed mutagenesis of bovine GJB1 be optimized for structure-function studies?

Site-directed mutagenesis is a powerful approach for studying structure-function relationships in bovine GJB1. Based on research practices, the following strategies can optimize this approach:

  • Mutation Design Strategy:

    • Target conserved residues identified through multi-species alignment to focus on functionally critical regions

    • Consider disease-associated mutations in human GJB1 (such as those causing CMTX1) as guides for functionally relevant sites

    • Implement systematic approaches such as alanine scanning of specific domains

    • Create mutation series that progressively alter charge, hydrophobicity, or size

  • Technical Optimization:

    • PCR-based site-directed mutagenesis has been successfully employed for GJB1

    • Use high-fidelity DNA polymerases to minimize off-target mutations

    • Include epitope tags (such as FLAG) that facilitate detection without compromising function

    • Consider codon optimization for the expression system being used

  • Functional Assessment Framework:

    • Compare expression levels, trafficking, and aggregation propensity between wild-type and mutant forms

    • Assess gap junction plaque formation through immunofluorescence microscopy

    • Evaluate stress responses by monitoring stress granule formation, which occurs at significantly higher rates in cells expressing mutant GJB1 (40-48%) compared to wild-type (24%)

    • Measure cell viability to assess potential cytotoxicity of mutants

  • Data Analysis Approach:

    • Implement quantitative image analysis to objectively assess localization patterns

    • Use statistical methods to determine significant differences in function or localization

    • Correlate molecular changes with functional outcomes

Research has demonstrated that mutations in different domains (e.g., F31S and W44G in the first transmembrane domain versus R220Pfs*23 in the C-terminal domain) produce distinct effects on protein behavior , providing valuable insights into domain-specific functions.

How does the recombinant bovine GJB1 model contribute to understanding human Charcot-Marie-Tooth disease (CMTX1)?

Recombinant bovine GJB1 serves as a valuable model for studying human CMTX1 due to the high sequence homology between bovine and human proteins. The model provides several specific advantages:

  • Disease Mutation Analysis:

    • Over 450 GJB1 mutations have been reported in CMTX1, making it the second most common form of CMT

    • Studies using recombinant GJB1 have revealed that mutations cause varying degrees of protein aggregation, with frameshift mutations like R220Pfs*23 showing the greatest tendency for aggregation and cytotoxicity

    • Different mutations lead to distinct cellular phenotypes that may explain clinical variability in CMTX1

  • Pathogenic Mechanisms:

    • Intracellular aggregation of GJB1 mutants has been identified as a key pathogenic mechanism

    • Stress granule formation is significantly increased in cells expressing mutant GJB1, indicating cellular stress responses

    • Impaired gap junction plaque formation contributes to loss of intercellular communication

  • Correlation with Clinical Findings:

    • The severity of cellular phenotypes often correlates with clinical presentations

    • Frameshift mutation R220Pfs*23, which shows the greatest cytotoxicity in cellular models, is associated with both peripheral neuropathy and CNS abnormalities in patients

    • This suggests that different cell types may have varying tolerance to specific GJB1 mutations

  • Therapeutic Target Identification:

    • p38 kinase has been identified as a potential therapeutic target, as inhibiting its activity restores gap junction assembly

    • Understanding how mutations affect protein trafficking and aggregation helps identify intervention points

    • The cellular phenotypes of different mutations suggest that personalized therapeutic approaches based on mutation type might be necessary

This model system allows researchers to replicate human disease mutations in a controlled experimental setting, providing insights into the molecular mechanisms underlying CMTX1 and potential therapeutic strategies.

What role do cellular stress responses play in GJB1-related pathology?

Cellular stress responses are emerging as critical components in GJB1-related pathologies. Recent research has uncovered several key aspects:

  • Stress Granule Formation:

    • Mutant forms of GJB1 induce significantly more stress granule (SG) formation than wild-type protein

    • Approximately 24% of cells expressing wild-type GJB1 showed SG formation, compared to 40-48% for cells expressing mutant forms

    • This indicates that mutant GJB1 triggers cellular stress response pathways

  • Protein Aggregation:

    • Both wild-type and mutant GJB1 can form aggregates, but mutants show significantly higher aggregation propensity

    • Aggregation likely occurs in the endoplasmic reticulum compartment rather than the Golgi apparatus

    • Sequential fractionation demonstrates elevated levels of aggregated forms in all mutants compared to wild-type

  • Cytotoxicity:

    • Cell viability assays reveal that GJB1 aggregates exhibit cytotoxicity

    • Frameshift mutation R220Pfs*23 shows greater cytotoxicity than missense mutations, potentially explaining the association of this mutation with central nervous system abnormalities

    • The degree of cytotoxicity correlates with the extent of protein aggregation

  • Signaling Pathway Interactions:

    • Cross-talk between growth factor signaling pathways (FGF and TGF-β) influences GJB1 function

    • p38 kinase activity mediates this interaction, with inhibition of p38 kinase restoring gap junction assembly

    • This represents a novel mechanism linking cellular stress responses to gap junction regulation

Understanding these stress responses provides insights into disease mechanisms and potential therapeutic targets for GJB1-related disorders like CMTX1. Interventions targeting protein aggregation, stress granule formation, or specific kinase pathways might offer therapeutic benefits.

What emerging technologies could advance our understanding of recombinant bovine GJB1 function?

Several cutting-edge technologies show promise for advancing GJB1 research:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Can reveal the structure of gap junction channels in near-native conditions

    • Allows visualization of different conformational states (open, closed)

    • Could provide insights into how mutations alter channel structure and function

  • Gene Editing Technologies:

    • CRISPR/Cas9-mediated knock-in of bovine GJB1 variants in relevant cell types

    • Generation of isogenic cell lines differing only in GJB1 sequence

    • Creation of animal models with specific GJB1 mutations to study in vivo effects

  • Advanced Imaging Techniques:

    • Super-resolution microscopy to visualize gap junction plaque architecture

    • Live-cell imaging to track GJB1 trafficking and turnover in real-time

    • Correlative light and electron microscopy to link functional and structural data

  • Proteomics Approaches:

    • Proximity labeling to identify GJB1-interacting proteins in different cellular compartments

    • Phosphoproteomics to map regulatory post-translational modifications

    • Thermal proteome profiling to identify compounds that stabilize GJB1 structure

  • Artificial Intelligence and Computational Methods:

    • Molecular dynamics simulations to predict effects of mutations on protein stability

    • Machine learning approaches to identify patterns in GJB1 aggregation and function

    • Systems biology modeling of gap junction communication networks

These technologies could provide unprecedented insights into GJB1 structure, function, and regulation, potentially leading to novel therapeutic approaches for GJB1-related diseases.

How might therapeutic strategies targeting GJB1 dysfunction be developed based on current research?

Current research findings suggest several promising therapeutic approaches for GJB1-related disorders:

  • Kinase Inhibition Strategy:

    • Inhibiting p38 kinase activity has been shown to restore gap junction assembly when disrupted by growth factor signaling

    • Targeted kinase inhibitors could potentially rescue trafficking defects in certain GJB1 mutants

    • This approach addresses the downstream effects of mutations rather than the mutant protein itself

  • Protein Stabilization Approach:

    • Small molecules that bind to and stabilize GJB1 could prevent aggregation

    • Pharmacological chaperones might facilitate proper folding and trafficking of mutant proteins

    • High-throughput screening could identify compounds that reduce GJB1 aggregation

  • Gene Therapy Options:

    • Delivery of wild-type GJB1 to affected tissues could complement mutant function

    • RNA-based therapies could selectively silence expression of mutant alleles

    • Gene editing approaches might correct specific mutations in patient-derived cells

  • Proteostasis Modulation:

    • Enhancing cellular protein quality control mechanisms to reduce accumulation of aggregated GJB1

    • Targeting the unfolded protein response to alleviate ER stress caused by mutant GJB1

    • Promoting selective degradation of aggregation-prone species

  • Personalized Medicine Approach:

    • Different mutations lead to distinct cellular phenotypes , suggesting mutation-specific therapies might be necessary

    • Frameshift mutations causing high cytotoxicity might require different interventions than missense mutations primarily affecting trafficking

    • Patient-derived cellular models could be used to test therapeutic efficacy for specific mutations

Research has shown that mutations in different domains have distinct effects on protein aggregation, trafficking, and cytotoxicity , indicating that therapeutic strategies may need to be tailored to specific mutation types.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.