Recombinant Bovine Gap junction beta-2 protein (GJB2)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is synthesized using recombinant DNA technology:

  • Expression System: E. coli BL21 strains .

  • Purification: Ni-sepharose affinity chromatography leveraging the His-tag .

  • Purity: >90% confirmed via SDS-PAGE .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0), stable at -80°C .

Reconstitution Guidelines:

  • Solubilize in sterile water (0.1–1.0 mg/mL).

  • Add glycerol (5–50%) for long-term storage .

Role in Hearing

GJB2 is essential for cochlear potassium ion (K⁺) recycling, maintaining endolymphatic potential critical for auditory transduction . Studies in Gjb2 knockout mice demonstrate:

  • Cochlear Degeneration: Untreated mice show hair cell loss by postnatal day 30 (P30) .

  • Therapeutic Rescue: AAV-mediated GJB2 delivery restores gap junction networks in Deiters’ cells, Hensen’s cells, and fibrocytes, preserving hair cells and improving auditory brainstem response (ABR) thresholds by 10–15 dB .

Cancer Prognosis

High GJB2 expression correlates with poor survival in cervical cancer (CC), linked to:

  • Clinical Factors: Tumor size, differentiation grade .

  • Pathways: p53 signaling and toll-like receptor pathways .

  • Chemoresistance: Positive correlation with cisplatin/paclitaxel resistance (Spearman r = 0.238/0.153) .

Applications in Biomedical Research

ApplicationExperimental UseSource
Hearing Loss ModelsRescue of cochlear morphology in Gjb2 knockout mice using AAV vectors .
Cancer StudiesPrognostic biomarker exploration in cervical, breast, and lung cancers .
Protein InteractionAnalysis of connexin assembly and gap junction permeability .

Clinical Relevance

Mutations in GJB2 cause ~50% of prelingual nonsyndromic hearing loss (DFNB1) . Recombinant GJB2 enables:

  • Gene Therapy Development: AAV9-PHP.B vectors with cell-specific promoters show promise in restoring auditory function .

  • Mechanistic Studies: Elucidating how connexin mutations disrupt K⁺ recycling and lead to deafness .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GJB2; Gap junction beta-2 protein; Connexin-26; Cx26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MDWGGLHTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGC KNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYYRHEKKRKFIRGEIKTEFKDIEE IKKQKVRIEGSLWWTYTGSIFFRVIFEAAFMYVFYVMYDGFAMQRLVKCNAWPCPNTVDC FVSRPTEKTVFTVFMIAVSGICILLNVTELCYLLIRFCSGKSKKPV
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely packed connexon transmembrane channels. These connexons facilitate the diffusion of low-molecular-weight materials between adjacent cells.

Gene References Into Functions
  1. The co-expression of connexins (Cx)26, Cx32, and Cx43 in bovine trophoblast giant cells supports their intermediate invasive status. PMID: 16310041
Database Links
Protein Families
Connexin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the structural difference between bovine GJB2 and human GJB2?

Bovine GJB2 shares approximately 86% amino acid identity with human GJB2, with conserved transmembrane domains but differences in extracellular loop regions. These structural variations affect gap junction plaque (GJP) formation efficiency and cellular localization patterns. The conserved regions include the critical arginine residue at position 75 (human position), which when mutated to tryptophan (R75W) in humans causes significant reduction in GJP length and functionality. Comparative structural analysis shows that bovine GJB2 forms similar hexameric connexons, though with species-specific differences in intercellular channel conductance properties .

What expression systems are optimal for recombinant bovine GJB2 production?

For functional recombinant bovine GJB2 expression, mammalian systems are strongly preferred over bacterial systems due to critical post-translational modifications. HeLa cells represent the gold standard expression system as they lack endogenous connexins, allowing clear interpretation of exogenous connexin behavior. For high-yield expression, a dual-vector system combining CBA (chicken β-actin) promoter with appropriate enhancer elements in HEK293 cells can be employed. Important methodological considerations include:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
HeLa cellsNo endogenous connexins, authentic traffickingLower yield0.8-1.2
HEK293 cellsHigher yield, mammalian PTMsSome endogenous connexins2.4-3.5
Sf9 insect cellsVery high yieldDifferent glycosylation5.0-7.0
E. coliHighest yieldNo PTMs, refolding required15-25

When expressing in HeLa cells, the use of specialized vectors with fluorescent protein tags enables real-time monitoring of gap junction plaque formation between adjacent cells .

How does the process of purifying recombinant bovine GJB2 differ from human GJB2?

  • Cell lysis with specialized detergent mixtures (1% n-dodecyl-β-D-maltoside with 0.1% digitonin)

  • Affinity chromatography using properly positioned tags (C-terminal is preferred over N-terminal)

  • Size exclusion chromatography to separate hexameric connexons

  • Optional reconstitution into liposomes or nanodiscs for functional studies

Critical considerations include maintaining the cold chain throughout purification (4°C) and including protease inhibitor cocktails optimized for membrane proteins. For comparative studies between bovine and human GJB2, parallel purification under identical conditions is essential to identify true species-specific differences rather than preparation artifacts .

What are reliable methods to assess bovine GJB2 gap junction functionality?

Multiple complementary approaches should be employed to comprehensively assess bovine GJB2 gap junction functionality:

  • Scrape Loading and Dye Transfer Assay: This technique quantifies gap junction intercellular communication (GJIC) by wounding a monolayer of cells immersed in Neurobiotin tracer, allowing assessment of dye transfer between adjacent cells through functional gap junctions. The procedure involves:

    • Growing cells to confluence

    • Washing with HBSS

    • Immersing in Neurobiotin tracer

    • Creating a wound with a scalpel

    • Allowing 5 minutes for dye exchange

    • Fixation, permeabilization, and immunostaining

    • Quantification of the area receiving Neurobiotin via gap junctions

  • Morphometric Analysis: Quantitative assessment of gap junction plaque dimensions provides valuable functional insights. Key parameters include:

    • Length measurement

    • Area calculation

    • Form factor determination

    • Length-to-area factor (LAF) analysis

  • Electrophysiological Measurements: Dual patch-clamp recordings between coupled cells provide the most direct functional assessment of gap junction conductance .

How can researchers detect and quantify expression of recombinant bovine GJB2 in transfected cells?

Comprehensive detection and quantification require multiple methodological approaches:

  • Immunocytochemistry/Immunofluorescence: Using anti-CX26 antibodies with appropriate controls to visualize cellular localization and gap junction plaque formation. Optimal fixation includes 4% PFA for 15 minutes followed by 0.1% Triton X-100 permeabilization. Counter-staining with membrane markers like cholera toxin subunit B helps distinguish genuine gap junction plaques from protein aggregates.

  • Western Blotting: Quantitative assessment requires careful membrane protein extraction optimized for connexins. Critical considerations include:

    • Using specialized extraction buffers containing 1% Triton X-100 and 0.5% deoxycholate

    • Avoiding sample heating above 37°C to prevent aggregation

    • Including negative controls when using antibodies cross-reactive between species

  • qRT-PCR: For transcript-level quantification, with carefully designed primers that distinguish between endogenous and recombinant transcripts when necessary.

  • Flow Cytometry: For population-level assessment of expression efficiency in transfected or transduced cell populations, particularly when using fluorescent protein fusion constructs .

How can bovine GJB2 be used in comparative studies of gap junction-related hearing loss?

Bovine GJB2 provides valuable comparative insights when investigating connexin-based hearing mechanisms across species. A methodologically sound experimental approach includes:

  • Parallel Expression Systems: Expressing bovine, human, and mouse GJB2 under identical conditions to identify species-specific variations in gap junction formation, trafficking, and function. This reveals evolutionary adaptations that may inform therapeutic approaches.

  • Mutation Analysis Framework: Introducing equivalent mutations (e.g., R75W) across species permits assessment of conserved pathogenic mechanisms. The experimental design should include:

    • Site-directed mutagenesis of conserved residues

    • Quantitative assessment of gap junction plaque morphology

    • Functional dye transfer assays

    • Protein interaction studies to identify species-specific binding partners

  • Heterotypic/Heteromeric Connexon Studies: Investigating the compatibility of bovine GJB2 with other connexins from different species provides insights into functional conservation and regulatory mechanisms .

What viral vector systems are most effective for delivering bovine GJB2 to cochlear cells?

Based on studies with human and mouse GJB2, the most effective viral vector systems for cochlear delivery include:

  • AAV9-PHP.B Vector: This engineered AAV variant shows excellent tropism for cochlear supporting cells, making it ideal for GJB2 delivery. Critical methodological considerations include:

    • Promoter selection: The ubiquitous CBA promoter drives strong expression but may cause toxicity, necessitating cell-specific promoters

    • Injection route: Round window membrane (RWM) injection at P0-P1 provides optimal cochlear access

    • Dosage optimization: Titration studies are essential as GJB2 overexpression can be lethal

  • AAV-GRE Systems: Vectors incorporating Gap junction Regulatory Elements (GREs) identified through ATAC-seq provide cell-specific expression, targeting the appropriate cell types while avoiding hair cells. This approach prevents the systemic toxicity observed with ubiquitous expression.

  • Timing Considerations: For developmental studies, injection at P0-P1 is critical as GJB2 plays essential roles in postnatal cochlear maturation, particularly before P8 .

What cellular models are optimal for testing bovine GJB2 mutations equivalent to human deafness mutations?

Several cellular models provide complementary insights:

  • HeLa Cell System: The preferred system for basic characterization due to absence of endogenous connexins. Methodology should include:

    • Transient transfection followed by stable integration for long-term studies

    • Co-culture systems with differentially labeled cells to assess heterocellular gap junction formation

    • Scrape loading-dye transfer assays to quantify functional communication

  • Cochlear-Derived Cell Lines: While more challenging, these provide a more physiologically relevant context. Available options include:

    • Organ of Corti-derived cell lines maintained at 33°C (conditional immortalization)

    • Primary supporting cell cultures (limited lifespan but highly physiological)

  • Immortalized Bovine Cochlear Cells: Where available, these provide the most directly relevant background for bovine GJB2 studies .

How can base editing technologies be optimized for correcting GJB2 mutations in bovine models compared to human models?

Base editing represents a promising approach for correcting point mutations in GJB2. For optimizing this technology across species models:

  • Guide RNA Design Strategy: Successful base editing requires careful sgRNA design that places the target mutation within the editing window. For bovine GJB2, this involves:

    • Analyzing PAM site availability near equivalent mutation sites

    • Designing species-specific sgRNAs with optimal alignment to target regions

    • Testing multiple guide designs to identify highest efficiency options

  • Editor Selection and Optimization: Key considerations include:

    • TadA8e variant selection based on target context (V106W variant shows improved efficiency for certain sequence contexts)

    • Assessment of bystander editing potential through comprehensive sequence analysis

    • Delivery method optimization (plasmid transfection vs. RNP delivery)

  • Efficiency Assessment Framework: Quantitative evaluation requires:

    • Direct genome sequencing

    • Amplicon sequencing analysis for accurate editing quantification

    • Functional restoration assays including gap junction plaque morphometric analysis

    • Off-target analysis focusing on sequence-similar sites .

What are the critical controls needed when developing gene therapy approaches targeting bovine GJB2?

Rigorous experimental design for gene therapy development requires:

  • Null Mutation Controls: Vectors containing frameshift mutations (e.g., 35delG equivalent) that ablate protein function serve as essential controls to distinguish between vector-related effects and GJB2-specific effects. In mouse models, these controls demonstrated that GJB2 null vectors did not cause the lethality observed with functional GJB2.

  • Cell-Specific Expression Controls: Comparing ubiquitous promoters (CBA) with cell-type-specific regulatory elements (GREs) is crucial for distinguishing therapeutic potential from toxicity. Methodological considerations include:

    • Detailed histological assessment of cochlear morphology

    • Cell-type-specific expression analysis through co-localization studies

    • Functional hearing assessments (ABR measurements)

  • Tag Impact Assessment: The introduction of epitope tags (e.g., HA) may impact GJB2 function, necessitating parallel studies with tagged and untagged constructs to identify potential artificial effects. Research has demonstrated that HA-tagged GJB2 can disrupt normal function in some contexts .

How should researchers approach heteromeric connexon studies involving bovine GJB2 and other connexins?

Heteromeric connexon studies require sophisticated methodological approaches:

  • Co-expression Systems: Controlled co-expression of bovine GJB2 with other connexins (particularly GJB6) using:

    • Dual promoter vectors with balanced expression

    • Inducible expression systems for temporal control

    • Differential tagging to distinguish protein localization

  • Functional Compatibility Assessment: Evaluating the formation and function of heteromeric channels through:

    • Co-immunoprecipitation studies to confirm protein-protein interactions

    • FRET analysis to assess proximity within connexons

    • Electrophysiological characterization of channel properties

  • Species Comparison Framework: Parallel studies of bovine, human, and mouse connexin combinations to identify species-specific interaction patterns and compatibility differences .

How should researchers address the potential lethality of GJB2 overexpression when working with recombinant bovine GJB2?

The observed lethality with GJB2 overexpression requires careful experimental design:

  • Dosage Titration: Systematic testing of vector concentrations to identify the threshold between therapeutic effect and toxicity. This should include:

    • Dose-response studies with careful monitoring of animal health

    • Temporal expression analysis to correlate protein levels with observed effects

    • Tissue-specific expression assessment to identify off-target expression

  • Inducible Expression Systems: Implementation of tetracycline-responsive or similar systems that permit temporal control of expression levels, allowing:

    • Gradual increase in expression levels

    • Termination of expression if adverse effects appear

    • Defined expression windows based on developmental requirements

  • Cell-Specific Targeting: Utilizing cochlear gap junction regulatory elements (GREs) identified through ATAC-seq to restrict expression to appropriate cell types, preventing systemic toxicity while maintaining therapeutic potential .

What strategies can overcome detection challenges in GJB2 genetic testing that might affect bovine models?

Advanced detection strategies that address common pitfalls include:

  • Comprehensive Mutation Screening Protocol: The detection of GJB2 mutations requires a multi-faceted approach due to potential large deletions that may be missed by conventional sequencing:

    • Sanger sequencing for point mutations and small indels

    • MLPA or similar techniques for copy number variations

    • Array-CGH for precise delineation of deletion breakpoints

    • PCR-based fragment analysis for deletion detection

  • Allele-Specific PCR Design: Developing primers that specifically amplify wild-type or mutant alleles, particularly useful for detecting deletions or complex rearrangements.

  • Interpretation Framework: Careful analysis of apparently homozygous results that may actually represent hemizygosity due to deletions on the other allele, requiring parental testing for confirmation .

What quality control measures are essential when producing recombinant bovine GJB2 for structural studies?

Producing high-quality recombinant protein for structural studies demands rigorous quality control:

  • Homogeneity Assessment: Multiple analytical techniques should confirm protein quality:

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Native PAGE analysis of oligomeric state

    • Dynamic light scattering for aggregation assessment

    • Negative stain electron microscopy for structural homogeneity

  • Functional Verification: Confirming that purified protein retains native properties through:

    • Reconstitution into liposomes followed by dye transfer assays

    • Electrophysiological characterization in artificial membranes

    • Binding studies with known interaction partners

  • Stability Optimization: Systematic screening of buffer conditions to identify optimal stability parameters:

    • Detergent screening for maximal stability

    • Thermal shift assays to identify stabilizing additives

    • Long-term storage condition optimization

These methodological considerations ensure that structural studies reflect the native properties of bovine GJB2 rather than artifacts of the preparation process .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.