Recombinant Bovine Gap junction beta-3 protein (GJB3)

Shipped with Ice Packs
In Stock

Description

Expression System:

  • Host: E. coli (strain not specified) .

  • Vector: Utilizes a GST-tagged plasmid for high-yield cytoplasmic expression .

Purification Protocol:

  1. Affinity Chromatography: His-tag-based nickel column purification .

  2. Buffer Composition: Stabilized in Tris/PBS with 6% trehalose (pH 8.0) .

  3. Purity: >90% verified by SDS-PAGE .

Biological Roles:

  1. Intercellular Communication: Facilitates direct transfer of ions (e.g., Ca²⁺), metabolites (e.g., cAMP), and small signaling molecules via gap junctions .

  2. Cellular Stress Regulation:

    • Mediates cystine uptake in cells with low SLC7A11 expression, critical for redox balance .

    • Knockdown induces autophagy and apoptosis via GCN2-eIF2α-ATF4 signaling .

  3. Disease Associations:

    • Overexpression linked to poor prognosis in colorectal (COAD) and lung (LUAD) adenocarcinomas .

    • Mutations cause erythrokeratodermia variabilis and sensorineural hearing loss in humans .

Comparative Analysis:

FeatureBovine GJB3Human GJB3
Amino Acid Length270 aa270 aa
Key Structural MotifsConserved extracellular loopsSimilar topology
Expression SystemE. coliMammalian cells (common)
Functional StudiesLimited in vivo dataExtensive cancer/metabolism studies

Experimental Use Cases:

  1. Mechanistic Studies:

    • Role in cystine transport and autophagy regulation .

    • Interaction with tumor-associated neutrophils in metastatic microenvironments .

  2. Therapeutic Development:

    • Antibody targeting (e.g., clone 3B4-1B3) for cancer therapy .

    • Drug screening for connexin channel inhibitors .

Technical Applications:

ApplicationProtocol DetailsCitation
Western Blot1:500 dilution; detects ~31 kDa
Immunofluorescence10 µg/mL concentration
ELISAGST-tagged protein as antigen

Challenges and Future Directions

  • Limitations: Lack of bovine-specific functional data; most insights extrapolated from human/mouse models .

  • Opportunities:

    • Structural studies to resolve channel gating mechanisms.

    • Development of bovine-specific antibodies for in vivo tracking.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice for shipping, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. We advise storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your reconstitution process.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is established during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJB3; Gap junction beta-3 protein; Connexin-31; Cx31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
GJB3
Target Protein Sequence
MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGC TNVCYDEFFPISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCTKLYDDT GKKHGGLWWTYLLSLVFKLLIEFLFLYLLHTLWYGFGMPRLVQCANVAPCPNTVDCYIAR PTEKKLFTYFMVGASAVCIVLTFCEICYLIFHRVVRSLHRKRQPGGRGHAPSASRASTCR CHHKLLEAGDLSPDSHDNKLCASAPTMTPI
Uniprot No.

Target Background

Function
A gap junction comprises a cluster of tightly packed pairs of transmembrane channels, known as connexons, facilitating the diffusion of low molecular weight materials between adjacent cells.
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is GJB3 and what is its functional significance in research?

Gap Junction Protein Beta 3 (GJB3) belongs to the connexin family of proteins that assemble into hexameric structures forming channels between adjacent cells. These channels, known as gap junctions, allow the direct transfer of ions and small molecules between cells, facilitating intercellular communication. GJB3 specifically forms connexons that regulate the passage of metabolites and secondary messengers between cells .

In research contexts, GJB3 has emerged as a significant protein of interest due to its involvement in various cellular processes and disease states. Studies have revealed that GJB3 plays critical roles in:

  • Intercellular signaling via direct cytoplasmic connections

  • Cellular metabolic homeostasis, particularly in cystine uptake

  • Cancer progression, especially in adenocarcinomas

  • Cell survival mechanisms and stress responses

  • Immune cell interactions, including neutrophil functioning

Understanding these diverse functions makes recombinant GJB3 an important tool for investigating intercellular communication mechanisms, cellular metabolism, and pathological conditions such as cancer .

How do expression patterns of GJB3 differ across tissue types?

GJB3 shows distinctive expression patterns across different tissues, with significant implications for researchers studying tissue-specific functions. Transcriptomic analyses from multiple studies reveal tissue-specific expression profiles that researchers should consider when designing experiments:

Tissue TypeRelative GJB3 ExpressionResearch Significance
Epithelial tissuesHighImportant for barrier function studies
Gastrointestinal tractVariable (elevated in COAD)Relevant for colorectal cancer research
Respiratory systemVariable (elevated in LUAD)Critical for lung cancer studies
Pancreatic tissueElevated in metastatic contextsSignificant for metastasis research

Researchers should note that GJB3 expression can be significantly altered in pathological states compared to normal tissues. For instance, GJB3 shows notable overexpression in colorectal adenocarcinoma (COAD) and lung adenocarcinoma (LUAD), correlating with patient survival outcomes . This differential expression makes GJB3 particularly valuable for comparative studies between normal and disease states.

What are the common expression systems for recombinant GJB3 production?

When selecting an expression system for recombinant bovine GJB3, researchers should consider several factors including protein folding requirements, post-translational modifications, and functional activity retention. While the search results don't specifically address bovine GJB3 expression systems, general principles for membrane protein expression can be applied:

  • Bacterial expression systems: E. coli remains the most commonly used system for recombinant protein expression due to its rapid growth, high protein yields, and economic advantages. For membrane proteins like GJB3, specialized strains designed for membrane protein expression offer better results .

  • Eukaryotic expression systems: For complex proteins requiring post-translational modifications, systems such as yeast (S. cerevisiae or P. pastoris), insect cells (using baculovirus), or mammalian cells (CHO, HEK293) may provide better functional protein yields.

  • Cell-free expression systems: These can be advantageous for membrane proteins like GJB3, allowing direct incorporation into artificial membranes or nanodiscs during synthesis.

When optimizing expression conditions, researchers should implement statistical experimental design methodologies, such as factorial designs, which have successfully been used to optimize bioprocesses. This approach allows for rapid and economical determination of optimal culture conditions with fewer experiments and minimal resources .

What experimental design strategies can optimize recombinant GJB3 expression?

Optimizing recombinant GJB3 expression requires a systematic approach to multiple variables. Implementing multivariant statistical design offers significant advantages over traditional univariant methods, where only one variable is altered at a time:

Using this multivariant approach enables researchers to characterize experimental error, compare effects between normalized variables, and gather high-quality information with minimal experiments. This statistical methodology has demonstrated success in optimizing culture conditions for soluble protein expression, achieving yields of up to 250 mg/L of functional recombinant protein in E. coli systems .

What purification challenges are specific to recombinant GJB3 and how can they be addressed?

Purifying membrane proteins like GJB3 presents several unique challenges compared to soluble proteins:

  • Membrane extraction challenges:

    • GJB3 must be extracted from membranes using detergents that maintain protein structure and function

    • Selection of appropriate detergent is critical (mild non-ionic or zwitterionic detergents often preferred)

    • Step-wise solubilization protocols may improve functional protein recovery

  • Protein aggregation issues:

    • Connexins like GJB3 have a tendency to aggregate during purification

    • Addition of stabilizing agents (glycerol, specific lipids) can reduce aggregation

    • Implementation of size exclusion chromatography steps helps remove aggregated protein

  • Functional verification:

    • Unique challenge of confirming channel-forming ability after purification

    • Incorporation into liposomes or planar lipid bilayers for functional testing

    • Dye transfer assays to verify channel formation

A systematic purification strategy typically involves:

  • Affinity chromatography (using histidine tags or antibody-based capture)

  • Ion exchange chromatography for intermediate purification

  • Size exclusion chromatography for final polishing and aggregation removal

Researchers should validate purified GJB3 through both structural analyses (SDS-PAGE, Western blotting) and functional assays that confirm channel-forming capability, aiming for approximately 75% homogeneity while maintaining biological activity .

How can researchers effectively study GJB3's role in intercellular communication?

Investigating GJB3's role in intercellular communication requires specialized techniques that can examine the transfer of molecules between cells:

  • Dye transfer assays:

    • Fluorescent dye loading (e.g., calcein-AM, Lucifer yellow) into donor cells

    • Time-course monitoring of dye transfer to adjacent cells

    • Quantification of transfer rates with and without GJB3 expression/inhibition

  • Electrophysiological techniques:

    • Double whole-cell patch-clamp recordings to measure electrical coupling

    • Measurement of junctional conductance between cell pairs

    • Determination of voltage-gating properties specific to GJB3 channels

  • cAMP transfer studies:
    A particularly relevant approach comes from GJB3's role in transferring cyclic adenosine monophosphate (cAMP) between cells. Research has demonstrated that GJB3 forms channels between pancreatic ductal adenocarcinoma (PDAC) cells and neutrophils, transferring cAMP from cancer cells to neutrophils . Researchers can implement:

    • FRET-based cAMP sensors to visualize real-time transfer

    • Radioactive or immunoassay-based quantification of cAMP movement

    • Co-culture systems to study heterocellular communication

  • Genetic manipulation approaches:

    • Knockdown/knockout of GJB3 using shRNA or CRISPR-Cas9

    • Site-directed mutagenesis to identify critical residues for channel function

    • Rescue experiments to confirm specificity of observed phenotypes

When studying GJB3's intercellular communication function, researchers should consider both homocellular (between the same cell types) and heterocellular (between different cell types) communication, as these may involve different regulatory mechanisms and functional outcomes .

What methods are effective for investigating GJB3's role in cellular metabolism and stress responses?

Recent research has revealed GJB3's critical role in cellular metabolism and stress responses, particularly in cancer contexts. To investigate these functions, researchers can employ several complementary approaches:

  • Transcriptomic analysis after GJB3 manipulation:
    Studies have shown that GJB3 knockdown induces a cellular stress response characterized by activation of starvation and autophagy pathways. RNA-sequencing analysis can identify differentially expressed genes and affected pathways following GJB3 depletion .

  • Stress signaling pathway analysis:

    • Western blot analysis for key stress response markers:

      • Phosphorylation of eIF2α

      • Activation of the GCN2-eIF2α-ATF4 signaling axis

      • Markers of autophagy induction (LC3I/II, p62)

    • Immunofluorescence microscopy to visualize autophagosome formation

    • Flow cytometry to quantify apoptosis induction following sustained stress

  • Metabolic profiling:

    • Targeted metabolomics to measure specific metabolites (e.g., cystine levels)

    • Isotope tracing experiments to track metabolic fluxes

    • Seahorse analysis to measure changes in cellular bioenergetics

TechniqueApplicationKey Measurements
RNA-seqGlobal transcriptional changesStress response gene signatures
Western blottingProtein level changesPhospho-eIF2α, ATF4, LC3I/II
MetabolomicsMetabolite profilingCystine, glutathione, amino acids
Seahorse analysisBioenergetic profilingOxygen consumption, glycolytic rate

Research has specifically demonstrated that GJB3 plays a crucial role in cystine uptake, particularly in cells with low SLC7A11 expression. Metabolic profiling revealed a significant decrease in cystine levels in GJB3-deficient cells, highlighting GJB3's importance in cellular amino acid metabolism .

How can researchers effectively study GJB3's role in cancer progression using in vivo models?

In vivo models provide critical insights into GJB3's role in cancer progression, particularly in metastasis. Based on recent research findings, several effective approaches can be implemented:

  • Metastasis models:
    A particularly informative model involves studying GJB3's role in pancreatic cancer liver metastasis. Researchers have established an effective approach by:

    • Injecting luciferase-expressing pancreatic cancer cells (e.g., KPC1199) into the spleen of mice

    • Creating stable GJB3 knockdown cell lines using shRNA lentivirus

    • Monitoring metastasis progression through bioluminescence imaging

    • Quantifying metastatic burden in the liver

    This approach revealed that GJB3 depletion significantly reduced liver metastasis burden, demonstrating GJB3's importance in the metastatic process .

  • Tumor microenvironment analysis:

    • Immunohistochemical analysis of tumor sections to evaluate:

      • Neutrophil infiltration (GJB3 overexpression increases neutrophil infiltration)

      • Apoptosis markers in tumor-associated neutrophils

      • Expression of death-inducing signaling complex genes (e.g., FasL)

    • Flow cytometry of tumor-infiltrating immune cells

    • Ex vivo co-culture systems to study tumor-immune cell interactions

  • In vivo therapeutic targeting:

    • Administration of GJB3-targeting antibodies to tumor-bearing mice

    • Evaluation of combination therapies (e.g., with immune checkpoint inhibitors)

    • Assessment of metastasis suppression and survival outcomes

Research has demonstrated that GJB3 affects not only cancer cell growth but also the tumor microenvironment, particularly through interactions with neutrophils. GJB3 depletion was shown to reduce neutrophil survival and promote neutrophil apoptosis, suggesting that GJB3 influences immune cell function within the tumor microenvironment .

What are the emerging therapeutic applications of GJB3 research?

Recent findings suggest several promising therapeutic applications emerging from GJB3 research:

  • GJB3 as a therapeutic target:
    Research has established GJB3 as a potential therapeutic target, particularly in cancers where it is overexpressed. Studies have demonstrated that:

    • GJB3 can be specifically targeted using antibodies

    • GJB3 targeting may be particularly effective in GJB3-dependent cancers

    • GJB3 knockdown induces cellular stress and autophagy-mediated cell death

  • Stratification of patients for targeted therapy:
    Correlations between GJB3 expression and patient survival outcomes suggest potential for:

    • Using GJB3 expression as a prognostic biomarker

    • Identifying patients likely to benefit from GJB3-targeted therapies

    • Combining GJB3 targeting with other approaches based on molecular profiling

  • Targeting metabolic vulnerabilities:
    GJB3's role in cystine uptake suggests therapeutic strategies focused on:

    • Exploiting metabolic dependencies in GJB3-overexpressing cancers

    • Combining GJB3 inhibition with agents that induce oxidative stress

    • Targeting cells with low SLC7A11 expression that depend on GJB3 for cystine uptake

  • Metastasis prevention:
    Given GJB3's role in promoting metastasis, therapeutic approaches might include:

    • Developing agents that block GJB3's interaction with neutrophils

    • Inhibiting cAMP transfer between tumor cells and neutrophils

    • Preventing neutrophil polarization and survival in the metastatic niche

These emerging applications highlight the potential clinical significance of GJB3 research, particularly in the context of cancer therapy. The role of GJB3 in various cellular processes, from intercellular communication to metabolic regulation and stress response, provides multiple avenues for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.