Recombinant Bovine Gap junction beta-6 protein (GJB6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
GJB6; Gap junction beta-6 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
GJB6
Target Protein Sequence
MDWGTLHTFVGGVNKHSTSIGKVWVTVLFVFRVMILVVAAQEVWGDEQEDFVCNTLQPGC RNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHEAARRFRRGETRSEFKDLED IKRQKVRIEGSLWWTYTSSIFFRIVFEAAFMYVFYFLYNGYHLPWVLKCGIQPCPNLVDC FISRPTEKTVFTIFMISASVICMLLNVAELCYLLLKVCFRRSKRAQTQKAPPNHALKESK QNEMNELISEGGQNAITGFPS
Uniprot No.

Target Background

Function
A gap junction is composed of a cluster of closely packed pairs of transmembrane channels, known as connexons, through which low-molecular-weight materials diffuse from one cell to an adjacent cell.
Database Links
Protein Families
Connexin family, Beta-type (group I) subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the molecular structure and function of bovine GJB6?

Bovine GJB6 (connexin-30) is a member of the connexin protein family that forms gap junction channels between adjacent cells. These channels permit the transport of nutrients, ions (particularly potassium), and small signaling molecules between cells . The protein contains four transmembrane domains with both N- and C-termini located on the cytoplasmic side of the membrane. In bovine tissues, GJB6 is expressed in several tissues including the brain, inner ear, skin (especially palms and soles), hair follicles, and nail beds . The primary function of GJB6 is to form hexameric structures called connexons that dock with connexons from adjacent cells to create gap junction channels, facilitating intercellular communication.

How does recombinant bovine GJB6 differ from native protein in experimental applications?

Recombinant bovine GJB6 is typically produced in expression systems such as E. coli, mammalian cells, or wheat germ cell-free systems, often with fusion tags (His, Avi, Fc, or GST) to facilitate purification and detection . While these systems can yield functional protein, several differences may impact experimental outcomes:

ParameterNative Bovine GJB6Recombinant Bovine GJB6
Post-translational modificationsComplete physiological modificationsMay lack or have altered modifications depending on expression system
Protein foldingNatural folding in cellular environmentMay require refolding if expressed in prokaryotic systems
PurityMixed with other cellular proteinsCan be isolated at high purity (>95%)
FunctionalityFull biological activityMay have reduced or altered functionality
Experimental controlLimited standardizationBatch-to-batch consistency possible

Researchers should validate recombinant protein function through gap junction coupling assays or electrophysiological measurements when designing experiments.

What are the recommended storage and handling conditions for recombinant bovine GJB6?

For optimal stability and functionality of recombinant bovine GJB6:

  • Store lyophilized protein at -20°C to -80°C

  • After reconstitution, aliquot to avoid freeze-thaw cycles

  • For short-term storage (1-2 weeks), keep at 4°C in buffer containing:

    • 20mM Tris-HCl (pH 7.5)

    • 150mM NaCl

    • 10% glycerol

    • Protease inhibitor cocktail

  • Avoid multiple freeze-thaw cycles which may cause protein aggregation and loss of function

  • When handling, maintain temperature at or below room temperature

  • For membrane proteins like GJB6, inclusion of mild detergents (0.1% n-Dodecyl β-D-maltoside) may improve stability

Activity testing should be performed periodically to ensure protein functionality is maintained.

What are the most effective expression systems for producing functional recombinant bovine GJB6?

The choice of expression system significantly impacts the functionality of recombinant bovine GJB6. Based on current research:

Expression SystemAdvantagesLimitationsYieldFunctionality
E. coliCost-effective, rapid production, scalableLimited post-translational modifications, inclusion body formationHighOften requires refolding
Mammalian cells (HEK293)Native-like post-translational modifications, proper foldingHigher cost, longer production timeModerateHigh
Wheat germEukaryotic post-translational modifications, fewer toxicity issuesSpecialized equipment neededModerateGood
Baculovirus-insect cellScalable, post-translational modificationsComplex methodologyHighVery good

For functional studies requiring properly folded GJB6 with appropriate post-translational modifications, mammalian expression systems (particularly HEK293 cells) are recommended . When studying protein-protein interactions or conducting structural analyses, incorporating fusion tags (His, Avi, or Fc) can facilitate purification without significantly compromising function.

How can researchers verify the functionality of recombinant bovine GJB6 in gap junction studies?

Verification of recombinant bovine GJB6 functionality requires multiple complementary approaches:

  • Dye transfer assays: Use gap junction-permeable dyes like Lucifer Yellow to assess intercellular communication

  • Electrophysiological measurements: Dual whole-cell patch clamp to measure gap junctional conductance

  • Scrape loading technique: To evaluate gap junction-mediated dye spread in cell monolayers

  • Fluorescence recovery after photobleaching (FRAP): To measure gap junction-mediated molecule exchange between cells

  • Immunofluorescence: To verify proper membrane localization and plaque formation at cell-cell contacts

  • Co-immunoprecipitation: To confirm interactions with other connexins like GJB2 (Cx26)

When conducting these assays, it's essential to include positive controls (cells expressing endogenous GJB6) and negative controls (cells lacking connexin expression or treated with gap junction blockers like carbenoxolone) .

What are the current in vivo delivery methods for recombinant GJB6 or GJB6-encoding vectors?

Several delivery methods have been developed for in vivo manipulation of GJB6 expression:

  • Viral vector delivery:

    • Bovine adeno-associated viral (BAAV) vectors have shown efficacy for inner ear delivery

    • Canalostomy (injection through semicircular canal) is an effective route for cochlear delivery

    • Viral vectors can encode GFP-tagged GJB6 to track expression

  • Non-viral methods:

    • Lipid nanoparticles

    • Polymer-based carriers

    • Electroporation (limited by tissue accessibility)

  • Route of administration (effectiveness ranking):

    • Canalostomy (highest for inner ear targeting)

    • Round window membrane application

    • Systemic delivery (limited by blood-tissue barriers)

Key considerations include vector tropism, promoter selection for cell-specific expression, and developmental timing. In neonatal mice (P4), canalostomy with BAAV vectors encoding GJB6 successfully promotes formation of gap junctions in cochlear non-sensory cells, though expression decays over time due to cochlear remodeling during development .

How does recombinant bovine GJB6 interact with other connexin proteins in heteromeric gap junctions?

Connexin 30 (GJB6) forms both homomeric (composed of single connexin type) and heteromeric (multiple connexin types) gap junction channels. Research findings on heteromeric interactions include:

  • GJB6-GJB2 (Cx30-Cx26) interactions:

    • Co-localize in supporting and epithelial cells of the organ of Corti

    • Form heteromeric connexons with distinct permeability properties

    • Coordinate expression depends on chromosomal spacing

    • Deficiency in one connexin can affect stability of the other, as seen in 35delG GJB2 mutants where GJB6 protein is significantly down-regulated

  • Interaction with Cx43:

    • Studies of related gap junction proteins demonstrate that PKP2 can increase Cx43 expression

    • CTTNBP2NL can dephosphorylate Cx43, affecting gap junction communication

    • These regulatory mechanisms may have parallel functions with GJB6

  • Functional consequences:

    • Heteromeric channels show different permeability characteristics than homomeric channels

    • Ion selectivity and permeability to second messengers varies with connexin composition

    • Gating properties (response to voltage, pH, calcium) differ between homo- and heteromeric channels

When studying GJB6 interactions in heteromeric contexts, co-immunoprecipitation, FRET analysis, and electrophysiological measurements of channel properties are recommended methodological approaches.

What are the molecular mechanisms of GJB6 mutations in hearing loss and skin disorders?

GJB6 mutations cause distinct pathologies through different molecular mechanisms:

  • Hearing loss (DFNB1B and DFNA3B):

    • Loss-of-function mutations disrupt potassium recycling in the inner ear

    • Reduced GJB6 expression affects endocochlear potential

    • BAAV-mediated Cre/LoxP recombination decreasing Cx26 expression leads to decreased endocochlear potential, increased hearing thresholds, and loss of outer hair cells

    • Disruption of gap junction channels (GJCs) in supporting cells impairs potassium homeostasis

  • Clouston syndrome (hidrotic ectodermal dysplasia):

    • Dominant mutations (primarily amino acid substitutions) affect skin, hair, and nails

    • Mutations lead to abnormalities in growth, division, and maturation of cells in hair follicles, nails, and skin

    • Some mutations create abnormal hemichannels with increased activity

    • Altered calcium handling may trigger cell death pathways

  • Common pathogenic mechanisms:

    • Protein misfolding and endoplasmic reticulum (ER) stress

    • Altered trafficking to cell membrane

    • Impaired channel formation or function

    • Disrupted interactions with partner proteins

When investigating these mechanisms, researchers should consider:

  • Cell type-specific effects (supporting cells vs. keratinocytes)

  • Developmental timing of expression

  • Compensation by other connexins

  • Dominant-negative effects in heterozygous conditions

How can recombinant GJB6 be applied in tissue engineering and regenerative medicine research?

The potential applications of recombinant GJB6 in tissue engineering include:

  • Inner ear regeneration:

    • Delivery of GJB6 via BAAV vectors promotes formation of gap junctions in cochlear non-sensory cells

    • Could potentially restore gap junction coupling in connexin-deficient models

    • May improve outcomes in hearing restoration approaches

  • Skin tissue engineering:

    • Recombinant GJB6 may improve intercellular communication in engineered skin equivalents

    • Could enhance barrier function and homeostasis in artificial skin constructs

    • Potentially useful for treating Clouston syndrome through targeted delivery

  • Neural tissue engineering:

    • GJB6 is expressed in brain tissues and may influence neuronal network formation

    • Could enhance cell-cell communication in engineered neural tissues

    • May improve functional integration of neural implants

  • Methodological considerations:

    • Stability and sustained delivery remain challenging

    • Vector-based approaches show more promise than direct protein delivery

    • Expression levels must be carefully controlled to avoid overexpression effects

    • Temporal targeting is critical, as extensive remodeling during development affects persistence of introduced GJB6

What are common challenges in obtaining functional recombinant bovine GJB6 and their solutions?

Researchers frequently encounter several challenges when working with recombinant bovine GJB6:

ChallengePossible CausesSolutions
Low expression yieldToxicity to host cells, protein degradationUse inducible expression systems, lower temperature induction, add protease inhibitors
Inclusion body formationImproper folding in prokaryotic systemsExpress in mammalian cells, optimize refolding protocols, use fusion partners (SUMO, MBP)
Poor membrane localizationTrafficking defects, aggregationVerify signal peptide integrity, optimize lipid composition, use specialized detergents
Lack of channel functionImproper oligomerization, missing post-translational modificationsExpress in eukaryotic systems, verify hexamer formation, test in gap junction-deficient cell lines
Batch-to-batch variabilityExpression conditions, purification methodsStandardize protocols, implement quality control steps, quantify functional protein

When troubleshooting, implement a systematic approach:

  • Verify protein expression using Western blotting with tag-specific and GJB6-specific antibodies

  • Assess protein folding using circular dichroism spectroscopy

  • Confirm membrane integration using membrane fractionation techniques

  • Evaluate oligomerization state using native PAGE or size exclusion chromatography

  • Test functionality in cellular assays (dye transfer, electrophysiology)

How should researchers interpret conflicting data on GJB6 function across different experimental models?

Conflicting data on GJB6 function can arise from multiple factors:

  • Species differences:

    • Bovine GJB6 may have subtle functional differences from human or murine orthologs

    • Compare sequence homology and functional domains across species before extrapolating findings

  • Experimental context:

    • Cell type-specific effects: GJB6 functions differently in supporting cells of the cochlea versus skin keratinocytes

    • Developmental stage: Expression patterns and roles change throughout development

    • Compensatory mechanisms may mask phenotypes in some models

  • Technical considerations:

    • Expression level variations between studies

    • Different fusion tags affecting function

    • Methodology differences in functional assays

  • Reconciliation approach:

    • Verify protein expression and localization in each model

    • Perform dose-response studies to account for expression differences

    • Use multiple, complementary functional assays

    • Consider the presence of other connexins that may compensate or interact

    • Examine background strains in animal models that may harbor modifying alleles

As seen in studies of Gjb2 mutant mice, downregulation of GJB6 occurs in 35delG homozygous mice, suggesting interconnected regulation that may explain some apparently contradictory findings .

What controls are essential when studying recombinant bovine GJB6 in hearing loss models?

When investigating recombinant bovine GJB6 in hearing loss models, the following controls are critical:

  • Genetic controls:

    • Wild-type animals/cells (positive control)

    • GJB6 knockout models (negative control)

    • Heterozygous models to assess gene dosage effects

    • Models with mutations in interacting genes (e.g., GJB2 mutants)

  • Expression controls:

    • Verification of expression levels using qPCR and Western blotting

    • Immunolocalization to confirm proper cellular and subcellular distribution

    • Time course studies to track expression stability (expression may decay over time)

  • Functional controls:

    • Non-functional GJB6 mutants to distinguish specific from non-specific effects

    • Gap junction blockers (carbenoxolone, flufenamic acid) as pharmacological controls

    • Rescue experiments using wild-type GJB6 in deficient models

  • Physiological assessment controls:

    • Age-matched controls for ABR (Auditory Brainstem Response) testing

    • Environmental noise exposure matching

    • Consistent measurement parameters (electrode placement, stimulus parameters)

    • Internal controls (e.g., measuring endocochlear potential alongside hearing thresholds)

Studies show that BAAV vectors can effectively deliver functional GJB6 via canalostomy, but expression may diminish over time due to cochlear remodeling, emphasizing the importance of temporal controls in long-term studies .

What are emerging technologies for studying bovine GJB6 at the single-molecule level?

Recent advances are enabling unprecedented insights into GJB6 at the single-molecule level:

  • Super-resolution microscopy techniques:

    • STORM (Stochastic Optical Reconstruction Microscopy) to visualize individual GJB6 molecules within gap junction plaques

    • PALM (Photoactivated Localization Microscopy) for tracking GJB6 movement in live cells

    • Lattice light-sheet microscopy for dynamic 3D imaging of GJB6 trafficking

  • Single-molecule biophysical approaches:

    • Atomic Force Microscopy (AFM) to measure conformational changes in individual GJB6 channels

    • Single-channel electrophysiology to characterize conductance properties

    • Optical tweezers to measure forces involved in channel gating

  • Advanced molecular techniques:

    • SpyCatcher/SpyTag systems for site-specific labeling of GJB6

    • Click chemistry for in situ visualization of newly synthesized GJB6

    • Single-molecule FRET to measure conformational dynamics

  • Computational approaches:

    • Molecular dynamics simulations of GJB6 channels

    • Machine learning analysis of gap junction plaque organization

    • Predictive modeling of ion/molecule permeation through GJB6 channels

These technologies will help elucidate subtle functional differences between wild-type and mutant GJB6, providing insights into disease mechanisms and potential therapeutic targets.

How might gene editing technologies be applied to correct pathogenic GJB6 mutations?

Gene editing approaches show promise for GJB6-related disorders:

  • CRISPR/Cas9-based strategies:

    • Precise correction of point mutations in Clouston syndrome

    • Knock-in of functional GJB6 in deletion cases

    • Base editing for specific nucleotide changes without double-strand breaks

    • Prime editing for flexible gene correction with minimal off-target effects

  • Delivery methods for inner ear applications:

    • BAAV vectors have demonstrated efficacy for inner ear gene delivery

    • Lipid nanoparticles for non-viral delivery

    • Round window membrane approaches for less invasive delivery

    • Canalostomy for targeted delivery to cochlear tissues

  • Delivery methods for skin applications:

    • Ex vivo correction of patient keratinocytes followed by grafting

    • Topical delivery systems using cell-penetrating peptides

    • Microneedle arrays for transdermal delivery

  • Methodological considerations:

    • Cell type-specific promoters to restrict expression to target tissues

    • Temporal control of expression using inducible systems

    • Combining gene correction with tissue engineering approaches

    • Potential immunogenicity of Cas proteins requiring transient expression systems

The combined application of BAAV-mediated gene delivery and CRISPR/Cas9 technology could enable targeted correction of GJB6 mutations in specific tissues, potentially treating both hearing loss and skin manifestations of GJB6-related disorders.

What is the potential for recombinant bovine GJB6 in high-throughput drug screening for connexin-related disorders?

Recombinant bovine GJB6 offers several advantages for high-throughput drug screening:

  • Assay platforms:

    • Cell-based gap junction communication assays using fluorescent dye transfer

    • Automated patch-clamp systems for functional measurements

    • Trafficking assays to identify compounds that correct mislocalization

    • ER stress reduction assays for mutations causing protein misfolding

    • Split-luciferase complementation assays for protein-protein interactions

  • Screening approaches:

    • Phenotypic screens using cells expressing GJB6 mutations

    • Target-based screens focusing on specific GJB6 domains

    • Pathway-focused screens targeting known connexin regulatory pathways

    • Repurposing screens using approved drugs to accelerate translation

  • Candidate therapeutic classes:

    • Chaperone molecules to assist protein folding

    • Trafficking enhancers to increase membrane localization

    • Channel activity modulators for gain-of-function mutations

    • Connexin mimetic peptides to restore gap junction function

    • Compounds enhancing expression of complementary connexins

  • Implementation considerations:

    • Select cell lines that minimize background connexin expression

    • Establish robust positive controls (functional GJB6) and negative controls (non-functional mutants)

    • Develop quantitative readouts amenable to automation

    • Consider the effects of compound treatment duration (acute vs. chronic)

High-throughput screening could identify compounds that modulate GJB6 function or expression, potentially leading to novel therapeutics for both hearing loss and skin disorders associated with GJB6 mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.