Recombinant Bovine Gap junction gamma-1 protein (GJC1)

Shipped with Ice Packs
In Stock

Description

Fundamental Characteristics of Gap Junction Proteins

Gap junction proteins constitute the fundamental building blocks of intercellular channels that permit direct communication between neighboring cells. These specialized membrane structures allow the diffusion of low molecular weight materials between cells, facilitating both electrical coupling and metabolic cooperation . The connexin family represents the primary components of gap junctions in vertebrates, with GJC1 being a significant member of this protein family.

GJC1 belongs to the gamma subgroup of connexins and has been previously designated as Gap junction alpha-7 protein (GJA7) . This protein is commonly referred to as Connexin-45 or Cx45, indicating its approximate molecular weight of 45 kDa . The nomenclature evolution reflects ongoing refinements in our understanding of connexin classification and structural relationships.

Gap junction channels form through the docking of two hemichannels (connexons), each contributed by adjacent cells. Each connexon consists of six connexin protein subunits arranged in a hexameric structure. When properly aligned, these hemichannels create continuous aqueous pores spanning both plasma membranes, establishing a direct cytoplasmic connection between neighboring cells that bypasses the extracellular space.

Molecular Structure of Bovine GJC1

Bovine GJC1 exhibits a complex molecular structure characterized by distinct domains that contribute to its channel-forming capabilities and regulatory functions. The protein features four transmembrane domains, two extracellular loops, one cytoplasmic loop, and cytoplasmic N-terminal and C-terminal domains that collectively determine its functional properties.

The complete amino acid sequence of bovine GJC1 has been characterized and includes multiple functional regions. According to available data, the full amino acid sequence begins with "MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC" and continues through several structural domains that facilitate membrane insertion, channel formation, and regulatory interactions . The sequence contains regions responsible for voltage gating, ion selectivity, and interactions with regulatory proteins.

The extracellular loops of GJC1 contain highly conserved cysteine residues that form disulfide bonds critical for hemichannel docking and gap junction formation. The cytoplasmic domains, particularly the C-terminal region, serve as regulatory sites susceptible to post-translational modifications that influence channel gating and protein turnover.

Production and Properties of Recombinant Bovine GJC1

Recombinant Bovine GJC1 is produced using advanced molecular biology techniques that enable controlled expression and purification of the protein for research applications. The production process typically involves gene cloning, host cell transformation, protein expression induction, and purification steps designed to yield functional protein with high purity.

Commercially available Recombinant Bovine GJC1 is typically supplied in a specialized storage buffer containing Tris-based components and 50% glycerol, which has been optimized to maintain protein stability during storage and handling . The recommended storage conditions for preserving protein integrity include -20°C for regular use and -80°C for extended storage periods . To prevent degradation, repeated freezing and thawing cycles should be avoided, with working aliquots maintainable at 4°C for up to one week .

The recombinant protein may incorporate various affinity tags to facilitate purification and experimental applications. These tags, which are determined during the production process, can include histidine (His), avidin (Avi), Fc, or glutathione S-transferase (GST) . The specific tag selection depends on the intended research application and purification strategy.

The standard quantity of commercially available Recombinant Bovine GJC1 is typically 50 μg, although other quantities may be available for specific research needs . Quality control measures ensure that the recombinant protein maintains proper folding and functional characteristics essential for experimental validity.

Functional Roles of GJC1 in Biological Systems

GJC1 serves multiple critical functions in cellular communication and tissue homeostasis across various organ systems. Its ability to form intercellular channels enables the coordinated activities essential for normal physiological processes.

Intercellular Communication

As a component of gap junctions, GJC1 facilitates direct cell-to-cell communication by forming channels that permit the passage of ions, metabolites, and signaling molecules between adjacent cells. This intercellular connectivity is fundamental to coordinated cellular responses and tissue function .

Tissue Expression Patterns

GJC1 exhibits a distinctive tissue distribution pattern, with significant expression in cardiovascular tissues, neural structures, and specialized tissues such as the trabecular meshwork of the eye. Research has demonstrated robust expression of GJC1 in human trabecular meshwork cells and tissues, implicating its role in regulating aqueous humor outflow and intraocular pressure . The protein localizes to the membrane between adjacent cells and along trabecular beams, as confirmed by immunohistochemical analyses .

Pathway Involvement

GJC1 participates in several critical biological pathways that maintain normal physiological function:

  1. Calcium Regulation in Cardiac Cells: GJC1 contributes to calcium signaling pathways in cardiac tissue, which is essential for synchronized contraction and normal heart function .

  2. Electric Transmission Across Gap Junctions: The protein facilitates electrical coupling between cells, enabling rapid signal propagation in excitable tissues .

  3. Gap Junction Assembly: GJC1 participates in the complex process of gap junction plaque formation and organization, which involves trafficking, docking, and assembly of connexin subunits into functional intercellular channels .

Pathway NameRelated ProteinsFunctional Significance
Gap junction trafficking and regulationMYO6A, GJB2, GJA4, MYO6B, GJA5, GJB3, DAB2, GJB5, GJA8, MYO6 Regulation of gap junction localization and turnover
Calcium Regulation in Cardiac CellsGJB4, CHRM4, GJB5, CX30.3, GJC2, RGS6, YWHAQ, KCNJ3, GJA8, CX35.4 Coordination of calcium signaling in heart tissue
Electric Transmission Across Gap JunctionsPANX1, PANX2, GJA10, PANX1B, PANX1A Facilitation of electrical coupling between cells
Gap junction assemblyGJA5, GJB3, CX30.3, GJA8, GJD3, GJB2, GJB4, GJB5, GJA4, GJB7 Formation and organization of functional gap junction plaques

Research Applications of Recombinant Bovine GJC1

Recombinant Bovine GJC1 serves as a valuable research tool across multiple scientific disciplines, enabling investigations into gap junction biology, intercellular communication mechanisms, and related physiological processes.

Antibody Production and Immunological Applications

Recombinant Bovine GJC1 serves as an antigen for generating specific antibodies used in various immunological techniques. These antibodies enable the detection and localization of GJC1 in tissues and cells through methods such as western blotting, immunohistochemistry, and immunofluorescence microscopy. Research has utilized such antibodies to demonstrate the expression and localization of GJC1 along trabecular beams in human eye tissues .

Functional Assays and Physiological Investigations

The recombinant protein enables functional studies examining the physiological roles of gap junctions in normal tissue function and their alterations in disease states. Research has shown that inhibition of gap junctions in the trabecular meshwork leads to increased aqueous humor outflow resistance and elevated intraocular pressure, suggesting that gap junction proteins, including GJC1, play important roles in ocular physiology and potentially in glaucoma pathogenesis .

Protein-Protein Interaction Studies

Recombinant Bovine GJC1 facilitates investigations of interactions between gap junction proteins and other cellular components. These studies help elucidate the regulatory mechanisms controlling gap junction assembly, function, and turnover, providing insights into the complex cellular machinery that governs intercellular communication .

Current Research Directions and Future Perspectives

Current research on GJC1 continues to expand our understanding of its biological significance and potential applications in biomedical science. Recent studies have elucidated its expression patterns in various tissues and its involvement in critical physiological processes.

Investigation of GJC1 in ocular physiology has revealed its robust expression in trabecular meshwork cells and tissues, indicating a potential role in regulating aqueous humor outflow and intraocular pressure . Studies have demonstrated that blockage of gap junctions in the trabecular meshwork significantly increases aqueous humor outflow resistance and causes intraocular pressure elevation in experimental models . These findings suggest potential implications for understanding and treating glaucoma, a leading cause of irreversible blindness characterized by elevated intraocular pressure.

Compared to other gap junction proteins such as GJA1 (Connexin-43), GJA8, and GJB6, GJC1 shows moderate expression levels in human trabecular meshwork cells, as determined by quantitative analyses of mRNA and protein expression . These expression patterns suggest specialized functions for different connexin isoforms within the same tissue.

Future research directions may include:

  1. Detailed characterization of tissue-specific functions of GJC1 across different organ systems

  2. Investigation of post-translational modifications of GJC1 and their impacts on channel properties

  3. Exploration of therapeutic strategies targeting GJC1 in diseases involving aberrant intercellular communication

  4. Development of advanced recombinant variants with enhanced stability or modified functional properties for specialized research applications

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
GJC1; GJA7; Gap junction gamma-1 protein; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-396
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
GJC1
Target Protein Sequence
MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGDADKKAARSKPYAMR WKQHRALEETEEDHEEDPMMYPEMELESEKENKDQNQSKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLVGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELEDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANIAQEQQYGSHEDNLPPDLETLQREIRMAQERLDLAIQAYNHQN NPHGSREKKAKVGSKAGSNKSSASSKSGDGKTSVWI
Uniprot No.

Target Background

Function

Gap junctions are composed of clusters of closely packed connexons, transmembrane channel pairs that facilitate the diffusion of low-molecular-weight materials between adjacent cells.

Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

How does bovine GJC1 differ from other connexin family members?

Bovine GJC1 belongs to the gamma-type subfamily of connexins. While sharing the general structural features of the connexin family (four transmembrane domains, intracellular termini), GJC1 has distinct functional properties:

  • It forms channels with relatively small conductance compared to other connexins

  • It shows unique voltage-gating properties, being more voltage-sensitive than some other connexins

  • Its C-terminal domain influences the channel's gating behavior through interactions with the cytoplasmic loop

Unlike some connexins that are tissue-specific, GJC1 is expressed in multiple tissues including cardiac tissue, where it plays a role in calcium regulation .

What are the optimal expression systems for producing recombinant bovine GJC1?

For recombinant bovine GJC1 production, several expression systems have proven effective, each with specific advantages:

Expression SystemAdvantagesConsiderations
Mammalian Cells (HEK293)Native folding and post-translational modificationsHigher cost, lower yield
E. coliHigh yield, cost-effectiveMay require refolding, lacks post-translational modifications
Wheat GermGood for toxic proteinsModerate yield
Cell-free SystemsRapid production, avoids toxicity issuesVariable yield and functionality

For functional studies requiring properly folded channels, mammalian expression systems are preferable. Cell-free translation systems supplemented with microsomal membranes have successfully produced functional connexins that assemble into hexameric structures with properties similar to those produced in vivo . When expressing in mammalian systems, co-expression with other connexins should be considered if studying heteromeric channels .

In which bovine tissues is GJC1 predominantly expressed?

GJC1 expression in bovine tissues shows a specific distribution pattern:

Tissue TypeRelative GJC1 ExpressionCo-expressed Connexins
Cardiac TissueHighGJA1 (Cx43), GJA5 (Cx40)
Vascular Smooth MuscleModerateGJA1 (Cx43), GJA4 (Cx37)
NeuronsModerateVarious, including GJD family
GliaLow to ModerateGJA1 (Cx43), GJB1 (Cx32)

In cardiac tissue, GJC1 is particularly important for the regulation of calcium in cardiac cells and is involved in electric transmission across gap junctions . The specific expression pattern suggests tissue-specific roles in intercellular communication, with cardiac function being a primary role for GJC1 .

What are the recommended methods for assessing GJC1 gap junction functionality?

Several complementary techniques are used to evaluate the functionality of GJC1 gap junctions:

  • Fluorescence Recovery After Photobleaching (FRAP):

    • Methodology: Cells expressing GJC1 are loaded with gap junction-permeable fluorescent dye. A selected cell is photobleached, and recovery of fluorescence (indicating dye transfer through gap junctions) is monitored over time.

    • Analysis: Recovery rate and extent indicate gap junction communication capacity.

    • Example application: FRAP analysis showed that leukemia cell line-derived exosomes significantly reduce fluorescence recovery rate in bone marrow stromal cells, indicating disruption of gap junction intercellular communication .

  • Electrophysiological Recordings:

    • Dual whole-cell patch-clamp to measure conductance between coupled cells

    • Single-channel recordings from reconstituted connexons in lipid bilayers

    • Measurement of voltage-dependent gating properties

  • Dye Transfer Assays:

    • Using gap junction-permeable tracers (Lucifer Yellow, calcein)

    • Microinjection or "scrape loading" techniques

  • Biochemical Oligomerization Assays:

    • Density gradient centrifugation to isolate 9S hexameric connexons

    • Native PAGE to analyze oligomeric state

    • Chemical crosslinking to stabilize protein complexes

For the most comprehensive assessment, combining multiple techniques is recommended. For example, structural studies can be complemented with functional assays to correlate structure with channel activity .

How can one distinguish between GJC1 hemichannels and complete gap junctions in experimental settings?

Distinguishing between GJC1 hemichannels (connexons) and complete gap junctions requires specific experimental approaches:

  • Immunolocalization Techniques:

    • Confocal microscopy with antibodies against GJC1

    • Gap junctions appear as punctate structures at cell-cell interfaces

    • Hemichannels show more diffuse membrane distribution

  • Functional Discrimination:

    • Extracellular calcium manipulation (low Ca²⁺ promotes hemichannel opening)

    • Dye uptake assays (hemichannels allow uptake from extracellular medium)

    • Gap junction blockers affecting complete channels vs. hemichannels

  • Biochemical Approaches:

    • Biotinylation of cell surface proteins to isolate hemichannels

    • Sucrose gradient centrifugation separating hemichannels (9S) from complete channels (13S)

    • Specific detergent extraction protocols

  • Advanced Imaging:

    • Super-resolution microscopy to visualize individual channel structures

    • Atomic force microscopy of membrane preparations

When designing experiments, consider that hemichannels and gap junctions have distinct physiological roles; hemichannels can mediate exchange with the extracellular environment, while gap junctions facilitate direct cell-cell communication .

Which proteins interact with bovine GJC1 in gap junction assembly and regulation?

Bovine GJC1 engages in multiple protein interactions that regulate its assembly, trafficking, and function:

Interaction PartnerType of InteractionFunctional Significance
Other Connexins (heteromeric)Direct assemblyAlters channel properties
C/EBPβTranscriptional regulationControls GJC1 expression levels
Cytoskeletal ElementsAnchorageStabilizes gap junction plaques
ZO-1ScaffoldingRegulates size and turnover of gap junctions
Kinases (PKA, PKC, MAPK)Post-translational modificationRegulates channel gating and turnover
CaveolinTraffickingInfluences membrane targeting
14-3-3 ProteinsRegulatoryAssists in transport from ER to plasma membrane

The N-terminal domain of connexins plays a critical role in determining which connexin isotypes can assemble into heteromeric channels. Cell-free expression systems have shown that while some connexins like α₁ (Cx43) and β₁ (Cx32) only form homo-oligomeric connexons when expressed as full-length proteins, they can form hetero-oligomeric structures when their N-terminal domains are modified .

Research has demonstrated that transcription factors like C/EBPβ can bind directly to the promoter region of connexin genes, regulating their expression levels . Understanding these interactions is crucial for designing experiments to study GJC1 regulation.

How do post-translational modifications affect GJC1 channel function?

Post-translational modifications (PTMs) of GJC1 are key regulators of channel assembly, trafficking, and gating:

  • Phosphorylation:

    • Multiple phosphorylation sites exist in the C-terminal domain

    • Protein kinases (PKC, MAPK, Src) modify channel gating properties

    • Phosphorylation influences half-life and turnover rate

    • Example: Phosphorylation of serine residues in the C-terminal domain can alter voltage sensitivity

  • Ubiquitination:

    • Tags GJC1 for degradation

    • Regulates the size of gap junction plaques

    • Controls protein turnover rate (connexins have relatively short half-lives)

  • S-Nitrosylation:

    • Affects channel permeability

    • Can be triggered by oxidative stress

  • Glycosylation:

    • While connexins are typically not glycosylated, engineered N-glycosylation sites have been used experimentally

    • N-glycosylation consensus sites can be introduced (as demonstrated with α₁ and β₁ connexins where Glu57→Ser in α₁Cx and Leu56→Ser in β₁Cx) without altering membrane integration or natural transmembrane topology

When studying GJC1 function, it's important to consider that the phosphorylation state may change during experimental procedures. Use phosphatase inhibitors during protein extraction if studying phosphorylation patterns. Additionally, site-directed mutagenesis of key PTM sites can provide valuable insights into their functional significance .

How does GJC1 contribute to intercellular calcium signaling in the cardiac system?

GJC1 (Cx45) plays a specialized role in cardiac calcium signaling through several mechanisms:

  • Selective Permeability:

    • GJC1 channels have a more restricted pore size compared to GJA1 (Cx43)

    • Allows passage of small signaling molecules and ions including Ca²⁺

    • Creates compartmentalized communication in specialized cardiac regions

  • Conduction System Specificity:

    • Predominantly expressed in the cardiac conduction system (sinoatrial node, atrioventricular node)

    • Forms heterotypic channels with other cardiac connexins

    • Contributes to the electrical isolation of pacemaker cells

  • Role in Development:

    • Essential for normal heart development

    • Loss of GJC1 leads to conduction abnormalities and developmental defects

  • Regulation During Pathology:

    • Expression changes during cardiac diseases

    • May contribute to arrhythmogenesis when expression is altered

    • Potential target for antiarrhythmic therapies

Methodologically, studying GJC1-mediated calcium signaling requires combining calcium imaging techniques (using indicators like Fluo-4) with gap junction modulation approaches. Specific inhibitors, genetic knockout models, or dominant-negative constructs can help isolate GJC1's contribution from other connexins. Co-expression with other cardiac connexins like GJA1 (Cx43) may be necessary to recapitulate physiological conditions .

What are the technical challenges in distinguishing GJC1 function from other co-expressed connexins?

Investigating GJC1-specific functions presents several technical challenges due to co-expression with other connexins:

  • Overlapping Expression Patterns:

    • GJC1 is often co-expressed with other connexins in the same cell types

    • In cardiac tissue, GJC1 coexists with GJA1 (Cx43) and GJA5 (Cx40)

    • Potential for functional redundancy complicates interpretation

  • Formation of Heteromeric and Heterotypic Channels:

    • GJC1 can form mixed channels with other connexins

    • Channel properties differ from homomeric channels

    • Difficult to attribute specific properties to GJC1 contribution

  • Limited Specificity of Pharmacological Tools:

    • Gap junction blockers (carbenoxolone, heptanol) affect multiple connexins

    • Lack of highly selective GJC1 inhibitors

    • Mimetic peptides may offer improved selectivity

To address these challenges, researchers can employ:

  • Genetic Approaches: Conditional knockout models, CRISPR/Cas9 editing, or siRNA knockdown specifically targeting GJC1

  • Dominant-Negative Constructs: Expression of modified GJC1 that disrupts channel function

  • Heterologous Expression Systems: Expressing individual or defined combinations of connexins

  • Advanced Imaging: Super-resolution microscopy to visualize channel composition

  • Electrophysiological Fingerprinting: Identifying characteristic channel properties

A study examining Cx43 in germ cells demonstrated that deletion of Gjc1 (coding for Cx45) did not significantly affect testis function, suggesting potential compensatory mechanisms involving other connexins . This highlights the importance of examining potential compensatory changes in other connexins when studying GJC1 function .

How do the voltage gating properties of GJC1 channels differ from other connexins?

GJC1 (Cx45) exhibits distinct voltage gating properties that set it apart from other connexins:

  • High Voltage Sensitivity:

    • GJC1 shows greater sensitivity to transjunctional voltage (Vj) than many other connexins

    • Channels begin to close at relatively small Vj values (±10-15 mV)

    • Complete channel closure occurs at ±40-50 mV

  • Gating Polarity:

    • GJC1 channels gate at negative polarity

    • This contrasts with connexins like Cx26, Cx30, and Cx40 that gate at positive polarity

    • The gating polarity is determined in part by charges in the N-terminal domain

  • Structural Determinants:

    • Several parts of the GJC1 molecule influence voltage gating:

      • N-terminal domain (NT)

      • First transmembrane domain (TM1)

      • Cytoplasmic loop (CL)

      • C-terminal domain (CT)

    • An important factor is the charge at the second amino acid position of the NT

  • Conformational Changes:

    • Three different N-terminal helix conformations have been identified in connexins:

      • Gate-covering (GCN)

      • Pore-lining (PLN)

      • Flexible intermediate (FIN)

    • These conformations contribute to the channel's gating properties

To study GJC1 voltage gating, dual whole-cell voltage clamp recordings are the gold standard method. This technique allows precise control of the voltage difference between coupled cells while measuring resulting current flow through gap junctions. When designing experiments, consider that factors such as pH, calcium concentration, and phosphorylation state can modulate voltage sensitivity .

What structural features determine GJC1's permeability to specific molecules?

The permeability characteristics of GJC1 channels are determined by specific structural elements:

  • Pore Architecture:

    • The GJC1 channel has a narrower effective pore diameter (~10-12Å) compared to some other connexins

    • The N-terminal domain forms a funnel structure that influences molecular selectivity

    • Conformational changes in the N-terminal helix can alter pore dimensions

  • Charge Distribution:

    • The pore lining contains charged residues that interact with permeants

    • Both the first extracellular loop (E1) and the N-terminal domain contribute to charge selectivity

    • GJC1 channels tend to be more cation-selective than some other connexins

  • Molecular Determinants:

    • Critical amino acids in the pore-lining regions influence selectivity

    • The transition between α-helix and π-helix in the first transmembrane domain creates a side opening to the membrane in some conformational states

    • These structural transitions can influence channel permeability

  • Dynamic Regulation:

    • Conformational equilibrium shifts can be induced by:

      • Cholesteryl hemisuccinates (shifts toward gate-covering conformation)

      • C-terminal truncations (shifts toward pore-lining conformation)

      • pH changes

The permeability of GJC1 channels allows passage of molecules up to approximately 1 kDa, including ions (K⁺, Ca²⁺), metabolites (glucose), and second messengers (IP₃, cAMP) . Experimental approaches to study permeability include dye transfer assays with molecules of different sizes, charges, and shapes, as well as direct electrophysiological measurements of ion selectivity .

How does GJC1 dysfunction contribute to disease states in model organisms?

GJC1 dysfunction has been linked to several pathological conditions across different model organisms:

  • Cardiovascular Disorders:

    • Loss of GJC1 in mice leads to swelling and blockage of the right ventricular outflow tract

    • Embryonic lethality at birth in GJC1 knockout mice demonstrates its vital role in heart development

    • Altered GJC1 expression contributes to arrhythmias and conduction disorders

  • Neurological Conditions:

    • GJC1 expression changes in response to nerve injury

    • May play a role in neuropathic pain states

    • Involved in neuronal communication via electrical synapses

  • Cancer Microenvironment:

    • Downregulation of GJC1 is observed in some leukemia models

    • BCR-ABL1-driven exosome-miR130b-3p can target GJC1 (Cx43) in bone marrow stromal cells

    • Disruption of gap junction intercellular communication contributes to the leukemic microenvironment

  • Development:

    • Essential for proper tissue organization and synchronized development

    • Participates in cell differentiation processes

    • Mutation or dysregulation leads to developmental abnormalities

When studying GJC1 in disease models, it's important to consider both cell-autonomous effects and the impact on intercellular communication networks. Conditional knockout approaches targeting specific tissues or temporal windows provide more precise insights than global knockouts, which may have lethal effects. Additionally, compensatory changes in other connexins should be carefully assessed when interpreting phenotypes .

What experimental models best capture the physiological roles of bovine GJC1?

Several experimental models have proven valuable for studying the physiological roles of bovine GJC1:

  • Genetically Modified Mouse Models:

    • Conditional knockout using tissue-specific Cre recombinase (e.g., cardiac-specific deletion)

    • Knock-in models with tagged or mutated GJC1

    • Domain swap experiments with other connexins to identify functional regions

  • Cell Culture Systems:

    • Primary bovine cell cultures (cardiomyocytes, smooth muscle cells)

    • Stable transfected cell lines expressing bovine GJC1

    • Co-culture systems to study heterocellular communication

    • 3D organoid cultures that better recapitulate tissue architecture

  • Ex Vivo Preparations:

    • Isolated perfused heart preparations

    • Tissue slices maintaining cellular architecture and connections

    • Langendorff heart preparation for functional studies

  • Reconstituted Systems:

    • Cell-free synthesis with microsomal membranes

    • Lipid bilayer reconstitution of purified connexons

    • These systems allow precise control of channel composition

  • Zebrafish Models:

    • Transparent embryos allow real-time imaging of development

    • Genetic manipulation is relatively straightforward

    • Useful for high-throughput screening

When selecting a model system, consider that bovine GJC1 shares high sequence homology with human GJC1 (approximately 98% identity), making bovine models relevant for human health applications. The choice of model should be guided by the specific research question—cellular mechanisms may be best studied in cell culture, while physiological integration requires intact tissue or animal models .

What are the critical quality control parameters for recombinant bovine GJC1 production?

Ensuring high-quality recombinant bovine GJC1 requires rigorous quality control across multiple parameters:

  • Protein Integrity and Purity:

    • SDS-PAGE to verify molecular weight (45.6 kDa)

    • Western blotting with specific antibodies

    • Mass spectrometry for sequence verification

    • Size exclusion chromatography to assess oligomeric state

    • Aim for >90% purity with minimal degradation products

  • Structural Integrity:

    • Circular dichroism to confirm secondary structure

    • Thermal stability assays to assess protein folding

    • Native PAGE to verify hexameric assembly

    • Negative stain electron microscopy to visualize connexon formation

  • Functional Activity:

    • Lipid bilayer reconstitution to verify channel formation

    • Electrophysiological recording of channel conductance

    • Dye permeability assays if reconstituted in liposomes

    • Cell-based assays if intended for cellular applications

  • Batch Consistency:

    • Lot-to-lot comparison of key parameters

    • Stability testing under various storage conditions

    • Endotoxin testing (especially for cell-based applications)

    • Aggregation assessment by dynamic light scattering

When producing recombinant bovine GJC1, it's crucial to maintain the native transmembrane topology. Cell-free systems supplemented with microsomal membranes can produce connexins with the correct topology and assembly into functional hexameric structures. Include appropriate controls in your quality control process, such as known standards of well-characterized connexin preparations .

How can I optimize solubilization and purification of recombinant bovine GJC1?

Optimizing the solubilization and purification of recombinant bovine GJC1 requires careful consideration of its membrane protein nature:

  • Solubilization Strategies:

    • Detergent Selection:

      • Mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin preserve native structure

      • Triton X-100 at 1% has been shown to maintain oligomeric connexin complexes

      • Test multiple detergents at various concentrations

    • Solubilization Conditions:

      • Buffer composition: phosphate or Tris-based (pH 7.4-8.0)

      • Salt concentration: typically 100-300 mM NaCl

      • Include protease inhibitors to prevent degradation

      • Perform at 4°C to maintain stability

  • Purification Protocol:

    • Affinity Chromatography:

      • Use His-tag, GST-tag, or Fc-tag depending on expression system

      • Specific anti-GJC1 antibodies for immunoaffinity purification

    • Size Exclusion Chromatography:

      • Separate hexameric connexons (9S particles) from monomers and aggregates

      • Buffer containing 0.1-0.2% detergent typically required

    • Ion Exchange Chromatography:

      • As a polishing step for further purification

      • Consider the theoretical pI of bovine GJC1

  • Stabilization Approaches:

    • Lipid Supplementation:

      • Addition of specific lipids can stabilize the protein

      • Cholesterol or phospholipids may improve stability

    • Nanodiscs or Amphipols:

      • Alternative to detergents for membrane protein stabilization

      • Better mimics native membrane environment

    • Temperature Control:

      • Maintain at 4°C throughout purification

      • Avoid freeze-thaw cycles

  • Quality Assessment:

    • Monitor oligomeric state by native PAGE or analytical SEC

    • Verify functionality through reconstitution experiments

    • Check for proper folding with limited proteolysis

For analytical purposes, sucrose gradient centrifugation has been successfully used to isolate oligomeric connexin complexes. Proteins solubilized in 1% Triton X-100 can be sedimented on sucrose gradients to separate oligomeric complexes (9S particles) from unassembled connexin polypeptides (5S particles) . When designing purification protocols, remember that connexins have relatively short half-lives, so work efficiently and include protease inhibitors throughout the process .

How can I design experiments to study heteromeric channels containing bovine GJC1?

Designing experiments to study heteromeric channels containing bovine GJC1 requires specialized approaches:

  • Controlled Co-expression Systems:

    • Dual Plasmid Transfections:

      • Use plasmids with different promoter strengths to control relative expression levels

      • Include distinct tags (e.g., His-tag on GJC1, FLAG-tag on partner connexin)

    • Bicistronic Vectors:

      • Ensure co-expression in the same cells

      • Control stoichiometry using IRES or 2A peptide sequences

    • Inducible Expression Systems:

      • Tetracycline-inducible promoters to control timing and level of expression

  • Verification of Heteromeric Assembly:

    • Co-immunoprecipitation:

      • Use antibodies against one connexin to pull down the partner

      • Western blot analysis with antibodies against both connexins

    • Proximity Ligation Assays:

      • Detect protein-protein interactions in situ

      • Provides spatial information about interaction sites

    • FRET Analysis:

      • Tag connexins with compatible fluorophores

      • Measure energy transfer as indication of proximity

  • Functional Characterization:

    • Electrophysiological Fingerprinting:

      • Heteromeric channels often have unique conductance and gating properties

      • Compare with properties of homomeric channels

    • Permeability Studies:

      • Test passage of different dyes and metabolites

      • Compare selectivity profiles with homomeric channels

    • Response to Modulators:

      • Heteromeric channels may have altered sensitivity to pH, Ca²⁺, or phosphorylation

  • Analytical Approaches:

    • Density Gradient Centrifugation:

      • Isolate connexons and analyze subunit composition

      • Immunoprecipitation from gradient fractions can confirm heteromeric assembly

    • Native Gel Electrophoresis:

      • Heteromeric connexons may show mobility differences

      • Western blotting with connexin-specific antibodies

What are the emerging techniques for studying bovine GJC1 dynamics and regulation in real-time?

Several cutting-edge techniques are transforming our ability to study bovine GJC1 dynamics and regulation in real-time:

  • Advanced Imaging Approaches:

    • Super-Resolution Microscopy:

      • STORM or PALM imaging resolves individual gap junction plaques

      • Tracks GJC1 movement and assembly at nanoscale resolution

      • Can be combined with multi-color imaging to track heteromeric interactions

    • Live-Cell TIRF Microscopy:

      • Visualizes insertion and removal of GJC1 from the membrane

      • Tracks trafficking of newly synthesized channels

    • Lattice Light-Sheet Microscopy:

      • Reduced phototoxicity for extended imaging periods

      • 3D visualization of gap junction dynamics

  • Genetically Encoded Sensors and Tags:

    • pH-Sensitive GFP Variants:

      • Monitor local pH changes affecting channel gating

      • Can be targeted to specific domains of GJC1

    • Split Fluorescent Proteins:

      • Visualize assembly of connexons into complete channels

      • Different color combinations for multiple connexin types

    • HaloTag or SNAP-Tag Fusions:

      • Pulse-chase labeling to track protein turnover

      • Compatible with super-resolution microscopy

  • Electrophysiological Innovations:

    • Automated Patch-Clamp Systems:

      • Higher throughput for pharmacological studies

      • Consistent recording conditions

    • Optogenetic Control:

      • Light-activated modification of channel properties

      • Precise temporal control of channel function

    • Nanoscale Electrodes:

      • Record from defined regions of gap junctions

      • Potentially resolve single-channel events

  • Cryo-Electron Microscopy:

    • Captures different conformational states of GJC1 channels

    • Reveals dynamic equilibrium between various channel conformations

    • Can identify three different N-terminal helix conformations: gate-covering (GCN), pore-lining (PLN), and flexible intermediate (FIN)

  • CRISPR-Based Approaches:

    • CRISPRi/CRISPRa:

      • Precisely control GJC1 expression levels

      • Study dose-dependent effects

    • Base Editing:

      • Introduce specific mutations without double-strand breaks

      • Study structure-function relationships

Recent studies using cryo-electron microscopy have revealed that GJC1/Cx43 exhibits dynamic equilibrium between different channel conformations in detergents and lipid nanodiscs. These techniques have identified conformational transitions in the first transmembrane helix that create side openings to the membrane in certain conformational states, providing unprecedented insights into channel regulation mechanisms . When implementing these techniques, consider that the experimental approach may influence channel behavior, and validation with complementary methods is recommended .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.