Recombinant Bovine Gastrin/cholecystokinin type B receptor (CCKBR)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Bovine CCKBR is a 48–49 kDa multipass transmembrane protein expressed in E. coli systems . It retains high affinity for both sulfated and nonsulfated CCK analogs, with >97% purity confirmed via SDS-PAGE . Key features include:

PropertyDetail
Gene ID281665 (Bovine)
Uniprot IDP79266
Expression SystemE. coli
Post-Translational ModificationsGlycosylation sites in the amino terminus
StabilityLyophilized form stable for 12 months at -20°C/-80°C

Domain Architecture

  • Seven transmembrane helices characteristic of G protein-coupled receptors (GPCRs) .

  • N-terminal extracellular domain: Contains glycosylation sites critical for ligand binding .

  • C-terminal intracellular domain: Essential for receptor internalization and signaling .

Signaling Mechanisms

  • Activates phosphatidylinositol-calcium secondary messengers upon ligand binding .

  • Modulates gastric acid secretion, mucosal growth, and neuronal activities (e.g., anxiety, analgesia) .

Gastrointestinal Functions

  • Stimulates histamine release from enterochromaffin-like (ECL) cells, driving gastric acid secretion .

  • Mediates trophic effects on gastric mucosa, as shown in CCKBR-deficient mice exhibiting mucosal atrophy despite hypergastrinemia .

Neuromodulatory Effects

  • Regulates dopamine and GABA release in the striatum and nucleus accumbens, influencing anxiety and locomotor activity .

  • Antagonism of CCKBR enhances dopamine release, suggesting therapeutic potential in Parkinson’s disease .

Cancer Associations

  • Overexpression linked to colorectal and pancreatic tumors due to aberrant splice variants .

Internalization Dynamics

  • Truncation of the C-terminal 44 residues reduces internalization efficiency to 26% (vs. 92% in wild-type) .

  • Serine/threonine residues in the C-terminus are critical for clathrin-mediated endocytosis .

Hypertrophy and Hypergastrinemia

  • Proton pump inhibitor (PPI)-induced hypergastrinemia increases ECL cell proliferation in wild-type mice but not in CCKBR⁻/⁻ models .

  • Serum gastrin levels in CCKBR-deficient mice reach 1,582 pg/mL (vs. 293 pg/mL in controls) .

ELISA Kits

  • Bovine CCKBR ELISA Kit (Assay Genie): Detects CCKBR in serum/plasma with sensitivity <0.1 ng/mL .

  • Applications include studying receptor expression in metabolic disorders and drug screening .

Ligand Interaction Studies

  • Used to evaluate binding kinetics of CCK/gastrin analogs and antagonists .

  • Example Data:

    LigandIC₅₀ (nM)Reference
    CCK-8 (sulfated)0.5
    Gastrin-171.2

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCKBR; Gastrin/cholecystokinin type B receptor; CCK-B receptor; CCK-BR; Cholecystokinin-2 receptor; CCK2-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-454
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
MELLKPNRSVLGSGPGPGASLCRSGGPLLNGSGTGNLSCEPPRIRGAGTRELELAIRVTL YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF IFGTVVCKAVSYFMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWM LSGLLMVPYPVYTAVQPAGPRVLQCMHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGL ISRELYLGLRFDGDSDSESQSRVGSQGGLPGGTGQGPAQANGRCRSETRLAGEDGDGCYV QLPRSRPALEMSALTAPTPGPGSGTRPAQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSAN TWRAFDGPGAHRALSGAPISFIHLLTYASACVNPLVYCFMHRRFRQACLDTCTRCCPRPP RARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
Uniprot No.

Target Background

Function
The gastrin and cholecystokinin type B receptor (CCKBR) is a receptor for gastrin and cholecystokinin. CCK-B receptors are found throughout the central nervous system, where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor exerts its effects by associating with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Database Links

KEGG: bta:281665

STRING: 9913.ENSBTAP00000006892

UniGene: Bt.582

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental structure of bovine CCKBR and how does it compare to other species?

Bovine Gastrin/cholecystokinin type B receptor (CCKBR) belongs to the G protein-coupled receptor (GPCR) superfamily with seven transmembrane domains. The receptor is structurally homologous to the CCKAR (approximately 50% amino acid homology), but differs in binding properties and internalization mechanisms . The recombinant form is typically expressed in E. Coli expression systems for research applications .

The receptor is also known by several synonyms including CCK-B receptor, CCK-BR, Cholecystokinin-2 receptor, and CCK2-R . The bovine CCKBR shares significant sequence homology with human, rat, and mouse variants, making it a useful model for comparative studies across species. The protein is predominantly localized to the cell membrane, where it functions as a receptor for both gastrin and cholecystokinin .

How do ligand binding properties of CCKBR differ from CCKAR?

The CCKBR exhibits distinct binding characteristics compared to its homolog CCKAR. While CCKAR binds cholecystokinin octapeptide (CCK-8) with much greater affinity than gastrin, CCKBR binds both CCK-8 and gastrin with nearly equal affinity . This differential binding profile has important implications for experimental design when studying receptor selectivity.

For research applications, understanding these binding properties is crucial when selecting appropriate ligands. The dual specificity of CCKBR allows researchers to use either gastrin or CCK-8 as experimental agonists, though care must be taken to account for potential differential downstream effects.

What signaling pathways are activated following CCKBR stimulation?

The CCKBR mediates its action through association with G proteins that activate a phosphatidylinositol-calcium second messenger system . Upon ligand binding, the receptor couples to pertussis toxin-insensitive G proteins, leading to the production of inositol phosphates and diacylglycerol . This signaling cascade ultimately influences various cellular processes including:

  • Modulation of central nervous system functions (anxiety, analgesia, arousal, and neuroleptic activity)

  • Regulation of cell proliferation (both stimulatory and inhibitory effects)

  • Cross-talk with other signaling pathways, particularly epidermal growth factor receptor (EGF-R) signaling

For research applications, inhibitors of various components of these pathways can be employed to dissect the specific contributions of each signaling branch to biological outcomes.

What are the optimal storage and handling conditions for recombinant bovine CCKBR?

Proper storage of recombinant bovine CCKBR is critical for maintaining protein stability and functionality. Based on manufacturer recommendations, the following storage protocol should be implemented:

  • Short-term storage: Store at -20°C

  • Extended storage: Maintain at either -20°C or -80°C

  • Working aliquots: Can be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as this can compromise protein integrity

The recombinant protein is typically supplied in liquid form containing glycerol, which acts as a cryoprotectant . When designing experiments, researchers should prepare small working aliquots to minimize freeze-thaw cycles and maintain protein functionality.

What detection methods are available for CCKBR in experimental systems?

Multiple detection methods can be employed to study CCKBR expression and function in experimental systems:

Detection MethodApplicationRecommended DilutionNotes
Western Blot (WB)Protein expression1:300-5000Detects denatured protein
ELISAQuantitative analysis1:500-1000High throughput screening
IHC-PTissue localization1:200-400Paraffin-embedded tissues
IHC-FTissue localization1:100-500Frozen tissue sections
IF(IHC-P)Co-localization studies1:50-200Immunofluorescence on paraffin sections
IF(IHC-F)Co-localization studies1:50-200Immunofluorescence on frozen sections
IF(ICC)Cellular localization1:50-200Immunocytochemistry

Commercially available antibodies against CCKBR are typically raised in rabbit hosts using KLH-conjugated synthetic peptides derived from human Gastrin receptor . These antibodies have confirmed reactivity with mouse and rat CCKBR, and predicted reactivity with human, cow, and rabbit variants .

How can receptor internalization be quantitatively measured in CCKBR studies?

Quantitative measurement of CCKBR internalization is critical for investigating receptor trafficking dynamics. Based on established protocols, the following methodological approaches are recommended:

  • Radioligand binding and acid wash technique:

    • Incubate cells with 125I-labeled ligands (such as 125I-BH-CCK-8)

    • At specific time points (e.g., 15, 30, 60, 120 minutes), treat cells with an acid wash solution (e.g., KSCN)

    • Calculate the percentage of internalization by determining the proportion of radioligand that is resistant to the acid wash

  • Confocal microscopy visualization:

    • Use fluorescently labeled ligands (e.g., rhodamine green-labeled CCK-8)

    • Counterstain the cell surface with a membrane marker (e.g., rhodamine B-labeled concanavalin A)

    • Visualize receptor internalization by the presence of intracellular green fluorescence

    • Colocalization of the surface marker and receptor (appearing yellow in merged images) indicates surface-bound receptors

These complementary approaches provide both quantitative data and visual confirmation of receptor internalization dynamics.

How does the carboxyl terminus influence CCKBR internalization?

The carboxyl terminus plays a critical role in regulating CCKBR internalization. Experimental evidence demonstrates that truncation of the receptor after amino acid residue 408 (deleting the C-terminal 44 residues) dramatically reduces internalization from 92% to only 26% . This region contains multiple serine and threonine residues that serve as potential phosphorylation sites.

Mutation studies have shown that replacing all serine and threonine residues in the carboxyl terminus with alanines (CCKBR ΔS/T) reduces internalization to 39%, accounting for the majority of the effect observed with truncation . This suggests that phosphorylation of the C-terminal region is a key regulatory mechanism for receptor internalization.

Notably, this regulatory mechanism appears to be specific to CCKBR, as similar mutations in the CCKAR do not significantly affect its internalization, highlighting important structural and functional differences between these highly homologous receptors .

What are the experimental approaches to distinguish between different internalization pathways of CCKBR?

Multiple experimental approaches can be employed to delineate the specific internalization pathways utilized by CCKBR:

  • Pharmacological inhibitors:

    • Clathrin-dependent endocytosis inhibitors (e.g., chlorpromazine, hypertonic sucrose)

    • Caveolae-dependent pathway inhibitors (e.g., filipin, nystatin)

    • Dynamin inhibitors (e.g., dynasore)

  • Genetic approaches:

    • Dominant-negative mutants of endocytic pathway components

    • siRNA knockdown of key proteins involved in different internalization routes

    • CRISPR/Cas9-mediated knockout of endocytic machinery components

  • Co-localization studies:

    • Dual-labeling with markers of different endocytic compartments

    • Live-cell imaging of receptor trafficking using fluorescently tagged receptors

    • Electron microscopy with immunogold labeling

Previous research has established that gastrin-bound CCKBR is internalized through a clathrin-dependent mechanism in transfected NIH/3T3 cells . Combining these approaches can provide comprehensive insights into the spatiotemporal dynamics of CCKBR trafficking.

How do phosphorylation patterns influence CCKBR function and trafficking?

Phosphorylation plays a critical role in regulating CCKBR function and trafficking. The receptor contains multiple potential phosphorylation sites, particularly in the carboxyl terminus, where 10 serine and threonine residues have been identified as potential phosphorylation targets .

While detailed phosphorylation patterns of CCKBR have not been fully characterized, experimental evidence supports a strong correlation between phosphorylation status and receptor internalization. Studies with site-directed mutagenesis of serine/threonine residues demonstrate that these potential phosphorylation sites are important determinants of receptor internalization .

This stands in contrast to the CCKAR, which is predominantly phosphorylated (>95%) in the third intracellular loop within seconds after agonist stimulation . Understanding these differential phosphorylation patterns between CCKAR and CCKBR provides insights into their distinct regulatory mechanisms.

How does CCKBR activation influence cell proliferation in different experimental models?

CCKBR activation has complex, context-dependent effects on cell proliferation that can be either stimulatory or inhibitory:

  • Direct inhibitory effects:

    • In AGS cells stably expressing CCKBR (AGS-GR cells), gastrin treatment (1 nM G17 for 72 hours) inhibits cell proliferation

    • This inhibitory effect is reversed by the gastrin-CCKB receptor antagonist L-740,093 (100 nM)

    • Time-dependent inhibition of [3H] thymidine incorporation is observed in response to gastrin

    • The inhibitory effect is detectable with physiologically relevant gastrin concentrations (<100 pM)

  • Indirect stimulatory effects:

    • Gastrin stimulation of CCKBR-expressing cells can lead to paracrine release of growth factors

    • These factors can stimulate proliferation in neighboring cells that do not express CCKBR

    • This has been demonstrated in coculture systems with AGS-GR cells (expressing CCKBR) and AGS-GFP cells (not expressing CCKBR)

These bidirectional effects highlight the importance of experimental design when studying CCKBR's role in proliferation, particularly the need to distinguish between direct receptor-mediated effects and indirect paracrine mechanisms.

What is the relationship between CCKBR signaling and epidermal growth factor receptor (EGF-R) pathways?

CCKBR signaling and EGF-R pathways exhibit significant cross-talk in cellular systems. Gastrin stimulation of CCKBR has been shown to increase production of ligands of the epidermal growth factor receptor . This represents an important mechanism by which CCKBR activation can indirectly influence cellular proliferation through transactivation of the EGF-R pathway.

The experimental approach to studying this cross-talk typically involves:

  • Stimulation of CCKBR-expressing cells with gastrin

  • Measurement of EGF-R ligand production (e.g., by ELISA or Western blotting)

  • Assessment of EGF-R activation (phosphorylation status)

  • Determination of downstream signaling events

  • Use of specific inhibitors to block either CCKBR or EGF-R to delineate the contribution of each pathway

Understanding this cross-talk is particularly important when designing experiments to assess the direct effects of CCKBR activation, as secondary effects through EGF-R activation may confound results if not properly controlled.

What experimental systems are optimal for distinguishing direct versus indirect effects of CCKBR activation?

To distinguish between direct and indirect effects of CCKBR activation, several experimental systems have been developed:

  • Coculture systems:

    • Culture of CCKBR-expressing cells (e.g., AGS-GR cells) together with non-expressing cells (e.g., AGS-GFP cells)

    • This allows observation of both direct effects on receptor-expressing cells and paracrine effects on non-expressing cells

    • Cell-specific markers or reporter systems can be used to distinguish between the two populations

  • Conditioned media experiments:

    • Collection of media from CCKBR-expressing cells stimulated with gastrin

    • Transfer of this conditioned media to non-expressing cells

    • Assessment of proliferation or other responses in recipient cells

    • This approach identifies soluble factors mediating indirect effects

  • Transwell systems:

    • Physical separation of CCKBR-expressing and non-expressing cells using permeable inserts

    • Allows diffusion of soluble factors without direct cell-cell contact

    • Enables assessment of paracrine signaling while maintaining distinct cell populations

  • Receptor antagonists and pathway inhibitors:

    • Selective blocking of CCKBR using specific antagonists (e.g., L-740,093)

    • Inhibition of potential downstream mediators (e.g., EGF-R inhibitors)

    • This approach helps delineate the contribution of different signaling pathways

These experimental systems provide robust methods for dissecting the complex effects of CCKBR activation on cellular functions.

How can CCKBR be utilized to study central nervous system functions?

CCKBR is expressed throughout the central nervous system where it modulates various neurological functions including anxiety, analgesia, arousal, and neuroleptic activity . To investigate these functions, several advanced experimental approaches can be employed:

  • Recombinant receptor expression in neuronal models:

    • Transfection of primary neuronal cultures or neuronal cell lines with recombinant bovine CCKBR

    • Assessment of electrophysiological properties using patch-clamp techniques

    • Calcium imaging to monitor intracellular signaling dynamics

  • Receptor-specific pharmacological tools:

    • Selective CCKBR agonists and antagonists to probe receptor function

    • Comparison with CCKAR-selective compounds to distinguish receptor subtype effects

    • Assessment of neuronal activity, neurotransmitter release, or behavioral outcomes

  • In vivo approaches:

    • Local administration of recombinant CCKBR or viral vectors encoding the receptor

    • Optogenetic or chemogenetic control of CCKBR-expressing neurons

    • Behavioral assessments of anxiety, pain perception, arousal states, or responses to neuroleptic drugs

Given CCKBR's role in modulating key neurological functions, recombinant bovine CCKBR serves as a valuable tool for comparative studies across species, potentially informing the development of therapeutic approaches for neurological and psychiatric disorders.

What research methodologies can address the constitutive activity of CCKBR isoforms?

Isoform 2 of CCKBR has been identified as constitutively activated and may regulate cancer cell proliferation via a gastrin-independent mechanism . To investigate this constitutive activity, several methodologies can be employed:

  • Site-directed mutagenesis:

    • Introduction of specific mutations that enhance or reduce constitutive activity

    • Creation of chimeric receptors between constitutively active and inactive isoforms

    • Assessment of downstream signaling in the absence of ligand stimulation

  • Inverse agonist studies:

    • Use of compounds that reduce constitutive activity (inverse agonists)

    • Differentiation from neutral antagonists that block ligand binding but don't affect constitutive activity

    • Quantification of basal signaling suppression

  • Advanced signaling assays:

    • BRET or FRET-based approaches to monitor receptor conformational changes

    • Label-free technology (e.g., dynamic mass redistribution) to assess integrated cellular responses

    • Real-time monitoring of second messenger production in the absence of ligand

  • Inducible expression systems:

    • Tetracycline-regulated expression of different CCKBR isoforms

    • Dose-dependent assessment of receptor expression and corresponding constitutive activity

    • Correlation between receptor levels and downstream effects on cell proliferation

These approaches provide comprehensive tools to investigate the molecular basis and biological significance of constitutive CCKBR activity, particularly in the context of cancer biology.

How can structure-function relationships of the CCKBR carboxyl terminus be systematically investigated?

Given the critical importance of the carboxyl terminus in CCKBR function, particularly in receptor internalization , systematic investigation of structure-function relationships in this region can provide valuable insights:

  • Progressive truncation analysis:

    • Creation of a series of C-terminal truncation mutants with varying lengths

    • Assessment of receptor expression, ligand binding, signaling, and internalization

    • Identification of minimal regions required for specific functions

  • Alanine scanning mutagenesis:

    • Sequential replacement of individual amino acids with alanine

    • Functional characterization of each mutant

    • Identification of specific residues critical for different aspects of receptor function

  • Phosphorylation site mapping:

    • Mass spectrometry analysis of phosphorylated residues following ligand stimulation

    • Creation of phosphomimetic (S/T to D/E) or phospho-deficient (S/T to A) mutations

    • Assessment of how specific phosphorylation events regulate receptor function

  • Interactome analysis:

    • Identification of proteins that interact with the CCKBR carboxyl terminus

    • Comparison between wild-type and mutant receptors to identify differential binding partners

    • Verification of interactions using co-immunoprecipitation, FRET, or proximity ligation assays

Mutation TypeEffect on InternalizationEffect on SignalingReference
Wild-type CCKBR92% internalizationNormal signaling
CCKBR Tr408 (C-terminal 44 residues deleted)26% internalizationNormal signaling
CCKBR ΔS/T (all Ser/Thr to Ala)39% internalizationNormal signaling

This systematic approach will provide a comprehensive map of structure-function relationships within the carboxyl terminus, potentially revealing new therapeutic targets and insights into receptor regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.