Recombinant Bovine GPI transamidase component PIG-S (PIGS)

Shipped with Ice Packs
In Stock

Description

Molecular Role of PIG-S

PIG-S is one of four essential subunits of the GPI transamidase, alongside PIG-T, GAA1, and GPI8 . Its functions include:

  • Formation of Carbonyl Intermediates: PIG-S is critical for the transamidase-mediated cleavage of the C-terminal signal peptide from precursor proteins, enabling covalent linkage to GPI anchors .

  • Complex Stability: PIG-T stabilizes the GPI transamidase complex, but PIG-S directly participates in catalytic activity .

  • Evolutionary Conservation: Bovine PIG-S shares structural and functional homology with human, yeast (Saccharomyces cerevisiae Gpi17p), and other eukaryotic orthologues .

Knockout Studies

  • Defective GPI Anchoring: Disruption of PIG-S in mouse F9 cells abolished surface expression of GPI-anchored proteins (e.g., Thy-1) and blocked carbonyl intermediate formation .

  • GPI Synthesis Unaffected: PIG-S knockout cells accumulated mature GPI lipids (e.g., H7, H8), confirming its role is exclusive to protein attachment, not GPI biosynthesis .

Complex Interactions

  • Subunit Assembly: PIG-S forms a stable complex with PIG-T, GPI8, and GAA1. Loss of PIG-T destabilizes the entire complex, reducing GAA1 and GPI8 expression .

  • Catalytic Mechanism: The transamidase cleaves precursor proteins via a carbonyl intermediate, with PIG-S directly involved in this step .

Table 2: GPI Transamidase Subunits and Roles

SubunitFunctionInteraction with PIG-S
PIG-TStabilizes complex, ER retention signalsDirect binding
GPI8Catalytic cysteine residueEssential for activity
GAA1Unknown; cytoplasmic N-terminusStabilized by PIG-T

Current Research Gaps

  • Bovine-Specific Data: Structural and kinetic details of bovine PIG-S remain uncharacterized.

  • Regulatory Mechanisms: How PIG-S cooperates with PIG-T in large mammals is unclear.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, kindly indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timelines, kindly consult your local distributors.
Please note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard protocol utilizes a final glycerol concentration of 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form exhibits a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
PIGS; GPI transamidase component PIG-S; Phosphatidylinositol-glycan biosynthesis class S protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-555
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
AATGAAATDLEVVRGKRAALFFATVVIVLGLPLWWKTTETYRAPLPYSQISGLNSLKLRL MVPVTVVFTQESVPLDDQEKLPFTVVHEREIPLKYKLKIKCRFQKAYRRALDHEEAALSL GNIQEAEAMLAEPSEQAEGSLTVYVISERCSLLPQDMMSYIGPKRMAVVRGITHREAFNI IGRRIIQVVQAMSLTEDVLAAALADHLPEDKWSSDKRRPLKSSLGYEITFSLLNPDPKSH DVHWDIEGAVRRYVQPFLSALSAAGNFSVDSQILYYAVLGVNPRFDSASSSYYLAAHSLP HVINPVESRLGSSAASLYPVLNFLLYVPELAHSPLYIQDKDGAPVATNAFHSPRWGGIMV YNVDPKAYNGSQLPVRVEVDMMRVMEVFLAQLRLLFGIAQPQLPPKCLFFGPKSEGIMTW ELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIKDDVASEVYRAVAAVQKAAEELSS GHLASAFAASQEAVTSSERAFFDPSLLHLLYFPDDQKFAIYIPLFLPMAVPILLSLFKIF LETRKSWKKPEKTD
Uniprot No.

Target Background

Function
GPI transamidase component PIG-S (PIGS) is a critical component of the GPI transamidase complex. It plays a vital role in the transfer of GPI (glycosylphosphatidylinositol) to proteins, particularly in the formation of carbonyl intermediates.
Database Links
Protein Families
PIGS family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structure of bovine PIG-S protein and how does it compare to human PIG-S?

Bovine PIG-S, like its human counterpart, is expected to consist of approximately 555 amino acids with two transmembrane domains positioned near the N- and C-termini. Based on human PIG-S structural characterization, the protein features a large hydrophilic region in the middle that likely adopts a luminal orientation when the N-terminus is positioned in the cytoplasm .

The structural conservation between mammalian PIG-S proteins suggests similar topological arrangements across species. In human studies, the lack of N-terminal methionine in expressed PIG-S protein indicated cytoplasmic orientation for the N-terminus, with the large middle hydrophilic domain positioned in the lumen .

Analysis of PIG-S homologs across species reveals moderate sequence conservation:

SpeciesAmino Acid LengthIdentity with Human PIG-SNotable Features
Human555100%Two transmembrane domains
S. cerevisiae53423%Similar hydrophobicity profile
S. pombe55427%Similar hydrophobicity profile

While specific bovine sequence identity percentages aren't provided in the available literature, mammalian proteins typically share higher conservation than across greater evolutionary distances, suggesting bovine PIG-S likely shares significant homology with human PIG-S .

What role does PIG-S play in the GPI transamidase complex?

PIG-S functions as an essential component of the GPI transamidase complex, which is responsible for attaching GPI anchors to proteins. The complex consists of at least four essential components: GAA1, GPI8, PIG-S, and PIG-T .

Functionally, PIG-S contributes to the transamidase activity particularly in the formation of carbonyl intermediates during the transfer of GPI to proteins. Knockout studies in mouse F9 cells have demonstrated that PIG-S is absolutely essential for GPI transamidase activity, as cells lacking PIG-S were defective in transferring GPI to proteins .

Within the complex, PIG-S forms physical associations with GAA1, GPI8, and PIG-T, helping to maintain the structural integrity of the entire enzymatic complex. The large hydrophilic region of PIG-S likely mediates these protein-protein interactions within the complex .

What are best practices for designing knockout experiments to study bovine PIG-S function?

When designing knockout experiments for bovine PIG-S, researchers should consider:

  • Experimental unit definition: Clearly define whether individual cells, culture plates, or animals constitute your experimental units. This is critical for proper statistical analysis and interpretation of results .

  • Power analysis: Conduct a power analysis before beginning experiments to determine the minimum sample size needed to detect significant effects. This prevents both resource waste and underpowered studies that fail to detect meaningful differences .

  • Randomization: Implement proper randomization techniques to minimize bias and confounding variables. This is particularly important when working with animal models where environmental factors can influence outcomes .

  • Control systems: Include appropriate controls including:

    • Non-targeted CRISPR controls to account for off-target effects

    • Phenotypic rescue controls (re-expression of bovine PIG-S) to confirm specificity

    • Wild-type controls to establish baseline function

  • Phenotypic assessment: Design comprehensive phenotypic assessment protocols that examine both direct effects on GPI-anchored protein expression and secondary cellular consequences .

When analyzing results, statistical considerations should include blocked experimental designs to control for batch effects in cell culture or animal variability .

How should I design expression systems for recombinant bovine PIG-S production?

When designing expression systems for recombinant bovine PIG-S, consider:

  • Expression system selection: Membrane proteins like PIG-S require expression systems that support proper folding and post-translational modifications. While bacterial systems offer high yield, mammalian cell systems (HEK293, CHO) better preserve native structure and function for transmembrane proteins .

  • Construct design: Include:

    • Appropriate purification tags (His, FLAG) positioned to avoid interference with transmembrane domains

    • Codon optimization for the selected expression system

    • Inducible promoters to control expression levels

    • Signal sequences if needed for proper membrane targeting

  • Experimental controls: Implement parallel expression of known functional proteins (such as recombinant bovine cytokines) to validate your expression system. For example, functional studies of recombinant bovine interleukins have demonstrated that proper folding and activity can be achieved in heterologous expression systems .

  • Purification strategy: Design a staged purification approach:

    • Initial membrane fraction isolation

    • Detergent solubilization optimization (test multiple detergents)

    • Affinity chromatography

    • Size exclusion chromatography for final purification

  • Activity validation: Establish functional assays to confirm the activity of your recombinant protein, potentially through reconstitution experiments with other GPI transamidase components .

What methods are most effective for studying PIG-S interactions with other GPI transamidase components?

For investigating interactions between PIG-S and other GPI transamidase components, multiple complementary approaches should be employed:

  • Co-immunoprecipitation (Co-IP):

    • Design antibodies or epitope tags specifically for bovine PIG-S and other components

    • Use gentle detergent conditions to preserve membrane protein complexes

    • Include appropriate negative controls (non-specific antibodies)

    • Validate results through reciprocal Co-IPs

  • Blue Native PAGE:

    • This technique preserves protein complexes during electrophoresis

    • Useful for determining the native molecular weight of the intact GPI transamidase complex

    • Can be followed by second-dimension SDS-PAGE to identify individual components

  • Crosslinking mass spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Digest crosslinked complexes and analyze by tandem mass spectrometry

    • Map specific interaction domains between PIG-S and other components

  • Fluorescence resonance energy transfer (FRET):

    • Tag PIG-S and potential interaction partners with appropriate fluorophores

    • Measure energy transfer as indication of protein proximity

    • Particularly useful for validating interactions in live cells

Research has demonstrated that PIG-S forms a complex with GAA1, GPI8, and PIG-T, with PIG-T playing a role in maintaining the complex by stabilizing the expression of GAA1 and GPI8 . These methodological approaches can help elucidate similar interaction networks in the bovine system.

What analytical techniques should be used to assess GPI anchor attachment defects in PIG-S studies?

When analyzing GPI anchor attachment defects in studies involving PIG-S manipulation, researchers should implement:

  • Flow cytometry analysis:

    • Stain cells with fluorescently-labeled antibodies against common GPI-anchored proteins

    • Use fluorescently-labeled bacterial toxins that bind specifically to GPI anchors

    • Quantify surface expression levels across populations of cells

    • Include appropriate controls (known GPI-anchor deficient cells)

  • Western blot analysis with phase separation:

    • Treat samples with Triton X-114 to separate GPI-anchored (detergent phase) from non-GPI-anchored proteins (aqueous phase)

    • Compare protein distributions between phases to assess anchoring efficiency

    • Monitor multiple GPI-anchored proteins to establish pattern of defects

  • Metabolic labeling:

    • Pulse-chase experiments with radioactive precursors to track GPI biosynthesis and attachment

    • Analyze intermediates that accumulate in PIG-S deficient cells

    • Particularly useful for identifying specific steps in the attachment process that are affected

  • Microscopy techniques:

    • Immunofluorescence to assess cellular localization of GPI-anchored proteins

    • High-resolution approaches to visualize redistribution in the absence of proper anchoring

    • Co-localization studies with ER and Golgi markers to identify trafficking defects

Previous research has demonstrated that PIG-S knockout cells show specific defects in the formation of carbonyl intermediates during GPI transfer, highlighting the precise biochemical step requiring PIG-S function .

How can I address inconsistent results in PIG-S functional assays?

When encountering inconsistent results in PIG-S functional assays, systematically evaluate:

  • Experimental design factors:

    • Replication adequacy: Ensure sufficient biological and technical replicates based on power analysis

    • Randomization implementation: Verify proper randomization to control for batch effects and other confounders

    • Experimental unit definition: Confirm your analysis matches your experimental unit definition

    • Blinding procedures: Implement blind assessment of outcomes to reduce unconscious bias

  • Technical considerations:

    • Protein stability: PIG-S is a membrane protein that may denature under certain conditions

    • Complex integrity: The four-component GPI transamidase requires all components for activity

    • Detergent selection: Test multiple detergents for optimal complex preservation during purification

  • Analytical approaches:

    • Data normalization: Apply appropriate normalization techniques to account for batch variability

    • Statistical models: Consider using mixed-effects models to account for hierarchical data structures

    • Outlier handling: Develop consistent protocols for identifying and addressing outliers

  • Validation strategies:

    • Cross-validate using multiple methodological approaches

    • Include positive controls with known GPI anchoring defects

    • Test multiple GPI-anchored proteins as readouts, as some may be more sensitive than others

The literature demonstrates that proper controls and replication are essential for reliable results in complex enzymatic systems like the GPI transamidase .

What are common pitfalls in experimental design when studying bovine PIG-S?

Researchers studying bovine PIG-S should be vigilant about these common experimental design pitfalls:

  • Inadequate definition of experimental units:

    • Incorrectly identifying the experimental unit leads to pseudoreplication and invalid statistical inference

    • Example: Treating multiple measurements from the same cell culture as independent replicates

    • Solution: Clearly define experimental units at the study design phase

  • Insufficient statistical power:

    • Underpowered studies waste resources and produce inconclusive results

    • Solution: Conduct proper power analysis before beginning experiments to determine sample size requirements

    • Consider effect size expectations based on previous PIG-S studies

  • Improper control selection:

    • Missing critical controls undermines result interpretation

    • Essential controls include wild-type comparisons, empty vector controls, and rescue experiments

    • When using CRISPR/Cas9, include non-targeting guide RNA controls

  • Overlooking complex stability factors:

    • The GPI transamidase complex requires all four components (GAA1, GPI8, PIG-S, PIG-T)

    • Research shows PIG-T maintains the complex by stabilizing expression of other components

    • Design experiments to monitor all components, not just PIG-S in isolation

  • Neglecting randomization and blinding:

    • Systematic reviews demonstrate the importance of randomization in animal trials

    • Implement proper randomization and blinding procedures to minimize bias

    • Document randomization methods in research protocols and publications

How can multi-omics approaches enhance our understanding of bovine PIG-S function?

Integrating multiple omics technologies offers powerful insights into bovine PIG-S function:

  • Proteomics applications:

    • Quantitative proteomics to identify the complete GPI-anchored proteome

    • Changes in protein abundance and localization in PIG-S deficient cells

    • Post-translational modification analysis of PIG-S and its interaction partners

    • Proximity labeling to map the entire protein neighborhood of PIG-S

  • Transcriptomics integration:

    • RNA-seq analysis of compensatory mechanisms in PIG-S deficient systems

    • Identification of regulatory networks affecting GPI biosynthesis

    • Alternative splicing events that may modify PIG-S function

    • Analysis of transcript stability and translation efficiency

  • Metabolomics approaches:

    • Profiling of GPI precursors and intermediates

    • Lipid composition changes in PIG-S deficient membranes

    • Metabolic flux analysis to understand the dynamics of GPI anchor biosynthesis

  • Integrated analysis strategies:

    • Correlation networks across multiple data types

    • Pathway enrichment incorporating multiple omics layers

    • Machine learning approaches to identify patterns across datasets

    • Systems biology modeling of GPI anchor attachment processes

These multi-omics approaches can reveal not only the direct effects of PIG-S dysfunction but also the broader cellular adaptation mechanisms and downstream consequences on cellular physiology .

What are future directions for therapeutic applications targeting the GPI transamidase system?

Research into the GPI transamidase system, including PIG-S, opens several promising therapeutic avenues:

  • GPI biosynthesis disorders:

    • Characterization of bovine PIG-S can inform human disease models

    • The high conservation of the GPI pathway across species makes bovine models valuable

    • Potential for enzyme replacement or gene therapy approaches targeting specific components

  • Parasitic disease interventions:

    • Many parasites rely heavily on GPI-anchored proteins

    • Species-specific differences in PIG-S and other components could be exploited

    • Structural studies of bovine PIG-S may identify targetable features in parasite homologs

  • Biotechnological applications:

    • Engineering modified GPI anchors for protein therapeutics

    • Creating cell surface display systems with controlled presentation of proteins

    • Developing biosensors utilizing GPI-anchored proteins

  • Methodological innovations:

    • Development of high-throughput screening systems for GPI transamidase modulators

    • Creation of in vitro reconstituted systems for mechanistic studies

    • Design of synthetic biology approaches to engineer novel GPI anchoring systems

Understanding the structural and functional details of all GPI transamidase components, including PIG-S, provides the foundation for these future applications in both basic research and therapeutic development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.