Recombinant Bovine Growth hormone receptor (GHR)

Shipped with Ice Packs
In Stock

Description

Mechanism of Activation and Signaling

GH binding induces GHR dimerization, triggering two primary pathways:

  1. JAK2-STAT Pathway:

    • JAK2 phosphorylates STAT5a/b, promoting nuclear translocation and gene transcription (e.g., IGF-1) .

    • STAT activation is critical for growth and metabolic regulation .

  2. JAK2-Independent Pathways:

    • Src family kinases (SFKs) activate ERK1/2 via Ras-like GTPases, influencing lipid and carbohydrate metabolism .

Key Residues and Conformational Changes:

  • Tryptophan 104: Essential for GH-GHR binding energy and dimer stability .

  • Exon 3 Deletion: Alters ECD conformation, reducing ERK1/2 signaling but preserving STAT5 activity .

Genetic Variants and Agricultural Applications

  • F279Y Polymorphism: A phenylalanine-to-tyrosine substitution in the transmembrane domain correlates with increased milk protein and fat content in Finnish Ayrshire cattle .

  • PRLR S18N: A linked polymorphism in the prolactin receptor enhances milk yield independently of GHR .

Tissue-Specific Expression and Regulation

  • Liver: GHR mRNA strongly correlates with IGF-1 levels, driven by GH signaling .

  • Pituitary Gland: No correlation between GHR and IGF-1, suggesting tissue-specific regulatory mechanisms .

  • Skeletal Muscle: In gilthead sea bream, rBGH upregulates GHR-I expression but suppresses IGF-IRb, indicating stage-dependent signaling .

Challenges and Future Directions

  • Antibiotic Resistance: rBGH-induced mastitis in cattle increases antibiotic use, raising concerns about resistant bacteria .

  • Detection Limits: Current assays struggle to quantify low rBGH levels in milk, necessitating advanced mass spectrometry methods .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
GHR; Growth hormone receptor; GH receptor; Somatotropin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-634
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
GHR
Target Protein Sequence
FSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVTLYLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEENKPRPLLIGGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP
Uniprot No.

Target Background

Function
The growth hormone receptor (GHR) is a receptor for pituitary gland growth hormone, playing a crucial role in regulating postnatal body growth. Upon ligand binding, it couples to and activates the JAK2/STAT5 pathway. The soluble form (GHBP) serves as a reservoir of growth hormone in plasma and may act as a modulator or inhibitor of GH signaling.
Gene References Into Functions

Gene References and Functions

  1. Most heifer reproductive traits were not significantly affected by CAST and CAPN1 markers, which are widely used to improve beef tenderness through selection. Breeders should not be concerned about how these markers influence reproduction and other heifer traits, with the possible exception of CAPN1's impact on calving date. PMID: 29448132
  2. No association was observed between the genotypes of GH and IGF-IS and fertility of Holstein cows raised in semi-extensive or intensive regimes. However, the STAT5 ABstEII polymorphism was linked to calving-first heat interval in Holstein cows raised in the intensive system. PMID: 27865414
  3. Hepatic growth hormone receptor and suppressor of cytokine signaling (SOCS)2 messenger RNA expression appeared to be promptly and sensitively regulated by increased estradiol levels before ovulation of dairy heifers PMID: 25704974
  4. A comparative study examined genetic diversity of the growth hormone receptor (GHR) in Tibetan cattle and Chinese Holstein cows. PMID: 25927168
  5. This research confirms the significance of CAPN1 and CAST for tenderness in beef, reveals a new effect of CAST on beef tenderness, and raises questions about the utility of GHR as a selection marker for beef quality. PMID: 24398843
  6. The data strongly support the high potential of the growth hormone receptor F279Y polymorphism as a marker for improving milk traits in selection programs. PMID: 21660490
  7. Six published GHR SNPs and seven novel GHR SNPs were associated with at least one of the traits, including milk yield, fat yield, protein yield, fat percentage, protein percentage, somatic cell score, calving interval, survival, and growth and size traits. PMID: 20528848
  8. Effects of GHR p.Phe279Tyr mutations on milk, fat, and protein yield, as well as fat and protein percentage in the milk of 1222 Holstein cows, were found to be significantly associated with protein percentage. PMID: 19781040
  9. Food deprivation-induced decrease in circulating IGF-I in steers is associated with a decrease in expression of different IGF-I mRNA variants and a specific decrease in expression of growth hormone receptor mRNA variants 1C3 and 1A in the liver. PMID: 12888636
  10. Insulin regulates the efficiency of GH signaling in the liver and adipose tissue of dairy cows by acting as a rheostat of GHR synthesis. PMID: 15113939
  11. Results show that chicken ovalbumin upstream promoter transcription factor II (COUP-TFII), hepatocyte nuclear factor 4alpha (HNF-4alpha), and HNF-4gamma regulate growth hormone receptor 1A promoter activity by binding to a common DNA element PMID: 15171724
  12. A study investigated allele and genotype frequencies of microsatellite markers located in the 5'-regulatory region of the IGF1 and GHR genes in beef cattle and the effects of these markers on growth and carcass traits in an intensive production system. PMID: 15670132
  13. The molecular evolution of GHR in the Bovidae family was investigated. PMID: 17044257
  14. Polymorphism in exon 10 of the growth hormone receptor (GHR) was found to play a role in body weight determination in three cattle breeds. Results indicated the presence of six genotypes: AA, BB, CC, AB, AC, and BC. PMID: 17369175
  15. FSH, but not E2, stimulated the expression of IR and GHR genes during follicular development. PMID: 17507188
  16. A single base substitution in the transmembrane domain encoding region of the GH receptor gene may influence the physiological properties of the receptor. PMID: 17693965
  17. The effect of single nucleotide polymorphisms in six genes and their associations with production factors in beef cattle are reported. PMID: 17785604
  18. Single nucleotide polymorphisms in GHR significantly affected feed intake, feed conversion, and body energy traits. PMID: 18650297
  19. Nine single nucleotide polymorphisms were identified. PMID: 18676722
  20. DGAT1 and growth hormone receptor alleles, which increase milk production, were found to have an adverse effect on reproduction, while the leptin allele responsible for increased milk production was linked to a marginally increased metritis frequency. PMID: 18822099
  21. Results indicate that the effects of polymorphism in ghr genes on cattle milk or meat production traits could be at least partially mediated through their effects on the igf1 gene expression in the liver and the IGF1 level in blood. PMID: 19112400

Show More

Hide All

Database Links
Protein Families
Type I cytokine receptor family, Type 1 subfamily
Subcellular Location
Cell membrane; Single-pass type I membrane protein.; [Growth hormone-binding protein]: Secreted.
Tissue Specificity
Highly expressed in both adult and fetal liver. Lower levels in kidney, anterior pituitary, skeletal muscle, adipose tissue and mammary gland.

Q&A

What is the bovine growth hormone receptor and how does it function in dairy cattle?

The bovine growth hormone receptor (GHR) is a transmembrane protein that serves as the binding site for both endogenous bovine somatotropin and its recombinant form (rbST). When activated, GHR initiates a signaling cascade that regulates numerous physiological processes including metabolism, growth, and lactation in cattle. The receptor contains an extracellular domain that recognizes and binds somatotropin, a transmembrane domain that anchors the receptor to the cell membrane, and an intracellular domain that initiates downstream signaling.

The functionality of GHR is particularly important in mammary tissue of dairy cows, where it mediates the galactopoietic effects of somatotropin. Research has shown that the specificity of this receptor is crucial for understanding species-specific responses, as bovine somatotropin has no effect on human growth hormone receptors due to structural differences .

How does bovine GHR differ structurally from human GHR?

Bovine GHR and human GHR exhibit significant structural differences that prevent cross-reactivity between species. This species specificity is a critical factor in safety assessments of rbST. The structural distinctions primarily occur in the extracellular binding domain, which prevents bovine somatotropin from activating human GHR.

Scientific evidence confirms that "the bovine recombinant somatotropin has no effect on human growth hormone receptors" . This finding has been central to regulatory assessments regarding the human safety of milk from rbST-treated cows. The species-specific nature of the receptor-hormone interaction is a fundamental concept in understanding the biological effects and safety profile of rbST.

What are the current transcriptomic approaches for studying GHR expression in bovine tissues?

Modern transcriptomic approaches have revolutionized the study of GHR expression in bovine tissues. High-throughput real-time PCR systems allow for the analysis of multiple genes simultaneously across large sample sets, making them particularly valuable for longitudinal studies of GHR expression patterns.

The methodology typically involves:

  • Sample collection: For in vivo studies, milk somatic cells (MSCs) provide a non-invasive sampling alternative to mammary tissue biopsies. MSCs can be easily collected during lactation, allowing for longitudinal monitoring of gene expression .

  • RNA extraction and quality assessment: Total RNA is isolated from collected samples following standardized protocols to ensure high-quality input material.

  • Reverse transcription and quantitative PCR: Using high-throughput real-time PCR platforms to analyze expression of GHR and related genes.

In recent studies, researchers have developed "a new transcriptomic system based on the use of high-throughput real-time PCR in combination with somatic cells" to monitor gene expression changes related to rbST administration . This approach allows for the simultaneous analysis of multiple genes, including those in the GH-IGF axis.

What experimental designs are most effective for studying GHR response to rbST in dairy cattle?

The most robust experimental designs for studying GHR response to rbST administration incorporate the following methodological elements:

  • Longitudinal study design: Extended monitoring periods before, during, and after rbST administration to capture both immediate and delayed effects on receptor expression and function.

  • Appropriate control groups: Inclusion of untreated animals maintained under identical environmental conditions.

  • Standardized dosing protocols: Administration following manufacturer recommendations, typically "500 mg of rbST subcutaneously every 14 days" as demonstrated in recent research protocols .

  • Systematic sampling schedule: Collection of samples at consistent intervals relative to rbST administration to account for cyclical effects.

A model experimental design from recent literature involved a study where "a total of nine cows, separated into control and rbST-treated groups" were monitored over an 8-month period with "rbST group treated with 500 mg of rbST subcutaneously every 14 days" for a total of 12 doses . This comprehensive approach allowed researchers to capture the full expression profile of target genes throughout multiple treatment cycles.

Which genes show altered expression in response to rbST administration?

Transcriptomic analysis has identified several genes that consistently show altered expression patterns in response to rbST administration. These genes can be categorized based on their biological functions:

  • Growth factor signaling pathway genes: IGF-1R (insulin-like growth factor 1 receptor) shows significant expression changes in response to rbST treatment .

  • Cell cycle regulation genes: CCND1 (cyclin D1) exhibits altered expression, reflecting changes in cell proliferation dynamics .

  • Inflammatory response genes: TNF (tumor necrosis factor) and IL-1β (interleukin 1 beta) show expression changes, indicating immunological responses to rbST administration .

Research has demonstrated that "the transcription of CCND1, IGF-1R, TNF and IL-1β genes resulted strongly influenced by rbST treatment" . These findings suggest that rbST administration affects not only direct growth hormone signaling pathways but also interconnected cellular processes related to proliferation and immune function.

How can gene expression profiles in milk somatic cells be used as biomarkers for rbST administration?

Gene expression profiles in milk somatic cells (MSCs) offer a promising approach for developing biomarkers to monitor rbST administration in dairy cattle. The advantages of this approach include:

  • Non-invasive sampling: MSCs can be collected during routine milking without causing stress to the animals.

  • Direct relevance: As the mammary gland is a primary target of rbST action, MSCs provide insights into localized effects.

  • Longitudinal monitoring: Enables repeated sampling from the same animals over extended periods.

Recent research has demonstrated that "the combination of MSCs, transcriptomic tools and statistical analysis has allowed the selection of four genes as potential biomarkers that could be used in a transcriptomic panel for monitoring rbST administration in cows" . These biomarkers show consistent expression changes in response to rbST treatment and can be detected using high-throughput qPCR methodologies.

When combined with statistical analysis methods, including both univariate and multivariate approaches, these gene expression profiles can effectively discriminate between rbST-treated and untreated animals.

What methodologies are used to assess potential health impacts of altered GHR signaling?

Research methodologies for assessing health impacts of altered GHR signaling typically follow a multi-tiered approach:

  • Molecular and cellular studies: Investigating receptor binding, signaling pathway activation, and downstream cellular responses in vitro.

  • Animal model studies: Evaluating physiological responses in laboratory animals, focusing on parameters such as immune function, growth patterns, and potential pathological changes.

  • Target animal studies: Monitoring health indicators in treated dairy cattle, including mastitis incidence, reproductive performance, and metabolic parameters.

Expert panels have evaluated the need for "chronic toxicity and reproductive studies in laboratory animals in the risk assessment of human food safety of rbST" . The methodological challenge lies in assessing indirect effects, as noted by researchers: "The implications of human exposure to slightly increased IGF-1 production (1% increment over normal exposure) would be impossible to study in any animal or human model" .

What are the methodological challenges in conducting long-term studies on GHR activation effects?

Researchers face several methodological challenges when designing and implementing long-term studies on GHR activation effects:

  • Study duration requirements: Chronic studies require extended monitoring periods, often spanning multiple lactation cycles in dairy cattle.

  • Control of environmental variables: Long-term studies must account for seasonal variations, management changes, and other environmental factors that might confound results.

  • Differentiation between direct and indirect effects: Distinguishing primary effects of GHR activation from secondary physiological adaptations requires careful experimental design.

  • Ethical considerations: Balancing research objectives with animal welfare concerns, particularly for invasive sampling procedures.

Expert assessments have concluded that "additional toxicology testing addressing indirect risks of IGF-1 exposure would be unwarranted" due to the challenges in designing studies that could detect "infinitesimally small" effects compared to normal physiological variations. This highlights the methodological limitations in studying subtle biological effects over extended timeframes.

How are advanced transcriptomic technologies enhancing our understanding of GHR function?

Advanced transcriptomic technologies are providing unprecedented insights into GHR function through:

  • Comprehensive gene expression profiling: "In recent years, transcriptomics technology has experienced a boom due to the development of RNA sequencing (RNA-seq), microarrays and high-throughput real-time PCR systems" . These technologies allow researchers to monitor expression changes across the entire transcriptome rather than focusing on preselected candidate genes.

  • Tissue-specific expression analysis: Modern techniques enable the comparison of GHR expression and signaling across different tissue types within the same animal.

  • Temporal dynamics analysis: High-throughput methods facilitate the study of time-dependent changes in gene expression following GHR activation.

Recent research has demonstrated that "high-throughput real-time PCR enables the analysis of various genes at the same time in a large number of samples" , providing comprehensive insights into the molecular mechanisms underlying GHR function.

What methodological approaches are being developed to study GHR polymorphisms and their functional implications?

Research into GHR polymorphisms is advancing through several methodological approaches:

  • Genotyping technologies: Next-generation sequencing and high-throughput genotyping platforms allow for rapid identification of genetic variants in the GHR gene across large cattle populations.

  • Structure-function relationship studies: Computational modeling and in vitro expression systems to determine how specific polymorphisms affect receptor structure, binding affinity, and signaling capacity.

  • Association studies: Correlating specific GHR variants with production traits, health parameters, and response to rbST administration.

These approaches enable researchers to understand how genetic variations in the GHR gene might influence individual responses to both endogenous growth hormone and rbST treatment. This emerging field has important implications for breeding programs and individualized management strategies in dairy production.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.