Recombinant Bovine herpesvirus 1.2 Envelope glycoprotein D (gD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a particular tag type.
Synonyms
gD; gIV; US6; Envelope glycoprotein D; gD; Glycoprotein IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-417
Protein Length
Full Length of Mature Protein
Species
Bovine herpesvirus 1.2 (strain ST) (BoHV-1) (Infectious bovine rhinotracheitis virus)
Target Names
gD
Target Protein Sequence
LPTPAPRVTVYVDPPAYPMPRYNYTERWHTTGPIPSPFADGREQPVEVRYAASAAACDML ALIADPQVGRTLWEAVRRHARAYNATVIWYKIESGCARPLYYMEYTECEPRKHFGYCRYR TPPFWDSFLAGFAYPTDDELGLIMAAPARLVEGQYRRALYIDGTVAYTDFMVWLPAGDCW FSKLDAARGYTFSACFPAREYEQNKVLRLTYLTQYYPQEAHKAIVDYWFMRHGGVVPPYF EESKGYEPPPAADGGSPAPPGDDEAREDEGETEDGAAGREGNGGPPGPEGDGESPTPEAN GGAEGEPKPGPSPDADRPEGWPSLEAITHPPPAPATPAAPDAVPVGVGIGIAAAAIACVA AAAAGAYFVYTRRRGAGPLPRKPKKLPAFGNVNYSALPG
Uniprot No.

Target Background

Function

Envelope glycoprotein that binds to host cell entry receptors. It may trigger membrane fusion with the host cell by recruiting the fusion machinery composed of gB and gH/gL.

Protein Families
Herpesviridae glycoprotein D family
Subcellular Location
Virion membrane; Single-pass type I membrane protein.

Q&A

What is the structural composition of Bovine herpesvirus 1.2 glycoprotein D (gD)?

Bovine herpesvirus 1.2 (BoHV-1.2) glycoprotein D is a major envelope protein that plays a critical role in viral pathogenesis. The structural analysis reveals that BoHV-1 gD shares significant amino acid sequence homology with other alphaherpesvirus gDs, notably 75% with Suid herpesvirus 1 (SuHV-1) and 65% with Human herpesvirus 1 (HHV-1) homologues .

How does glycoprotein D function in BoHV-1 viral entry into host cells?

Glycoprotein D plays an essential role in BoHV-1 entry into permissive cells through a complex multi-step process:

  • Initial Attachment: While gD is not involved in the initial attachment (which is mediated by gC and/or gB binding to cell surface heparan sulfate proteoglycans), it is crucial for subsequent steps .

  • Receptor Binding: The binding of gD to one of its cell surface receptors is essential for herpesvirus entry. This interaction targets a series of subsequent interactions between gB and the gH-gL complex that occurs concurrently with fusion .

  • Receptor Specificity: Unlike other alphaherpesviruses, BoHV-1 gD primarily interacts with nectin-1 (also known as HveC and Prr1) on epithelial and neuronal cells. Cells expressing heparin sulfate-modified 3-O-sulfotransferases or the HVEM receptor are not susceptible to BoHV-1 .

  • Fusion Process: Following receptor binding, gD works cooperatively with gB, gH-gL complex, and gK to facilitate fusion of the viral envelope with the plasma membrane of the cell .

What expression systems have been used to produce recombinant BoHV-1 gD?

Multiple expression systems have been used to produce recombinant BoHV-1 gD with varying levels of success:

Expression SystemAdvantagesLimitationsKey Findings
Prokaryotic (E. coli)Simple, high yieldLow efficacy, non-glycosylatedDespite higher total antibody levels induced, only a small portion were capable of neutralizing the virus
Yeast (Pichia pastoris)Secreted forms possible-Secreted forms of gD from BoHV-1 alone, or in combination with bovine IL-6 as a chimeric protein, induced neutralizing antibodies in mice
Plant cells (Tobacco Mosaic Virus-based)Cytoplasmic non-glycosylated form-Mice and cattle immunized developed humoral and cell-mediated immune responses with partial protection
Mammalian cells (MDBK)Most authentic formToxic when constitutively expressed at high levelsStable cell lines established when gD was placed under inducible promoter control or expressed at basal levels
Insect cellsCan produce authentic forms-Successfully used but fewer details provided in the literature

For mammalian expression, a secreted version of BoHV-1 gD (also called tgD) produced in MDBK cells under the control of an inducible bovine heat shock 70A gene promoter (HSP70 promoter) has been widely used .

How does glycosylation affect the immunogenicity of recombinant BoHV-1 gD?

Glycosylation significantly impacts the immunogenicity of recombinant BoHV-1 gD through complex mechanisms affecting both humoral and cell-mediated immune responses:

  • T-cell Recognition: Enzymatic deglycosylation of gD from BoHV-1 suggests that carbohydrate addition masks epitopes involved in T-cell recognition. This was demonstrated in experiments with rabbits where a stronger delayed-type hypersensitivity (DTH) response was observed in animals vaccinated with deglycosylated gD compared to native gD .

  • Antibody Response: Interestingly, the total antibody response to gD after carbohydrate removal was lower than the response observed for native gD-vaccinated animals .

  • Functional Antibody Activity: Despite the reduction in total antibody levels, the neutralizing antibody response and the ability of the antibodies to mediate cell lysis were not significantly reduced in animals receiving deglycosylated gD. This suggests that most functional epitopes on this glycoprotein are carbohydrate-independent .

  • N-glycosylation Sites: Analysis of gD from BoHV-1 identified N-glycosylation sites at amino acid positions 41 and 102, which are conserved in the reference sequence .

These findings are critical for designing optimal recombinant gD vaccines, as the expression system chosen will affect glycosylation patterns and consequently immunogenicity.

What are the methodological approaches for engineering recombinant BoHV-1 and BoHV-5 with modified gD genes?

Engineering recombinant BoHV with modified gD genes typically follows these methodological approaches:

  • BAC-based Recombination System:

    • Bacterial artificial chromosome (BAC) systems have been used to create recombinant viruses .

    • The complete viral genome is maintained as a BAC in E. coli, allowing precise genetic modifications.

  • Two-step Red Recombination Strategy:

    • First step: Deletion of the gD gene and replacement with a selection marker (e.g., kanamycin resistance gene).

    • Second step: Replacement of the selection marker with the modified gD gene .

  • Plasmid Construction for Homologous Recombination:

    • Creation of plasmids containing homology arms flanking the desired modification.

    • For example, in constructing fBoHV-5ΔgDkanᴿ BAC, a 2,832-bp transfer fragment containing 477 bp upstream of the gD5 start codon, a kanamycin cassette flanked by FRT sites, and 421 bp downstream of the gD5 stop codon was used .

  • Generation of Marker-Tagged Recombinants:

    • Addition of epitope tags (e.g., HA tag, V5 tag) or fluorescent proteins (GFP, RFP, YFP) to identify and track recombinant viruses .

    • Example primer design for adding tags shown in the table below:

PrimerSequenceFunction
P55′-ATAAGAATGCGGCCGCATGAAGGGCCGACATTGGCCGTGC-3′Amplification of gD1 ORF fused to HA
P65′-GATCGAATTCTCAAGCATAATCTGGAACATCATATGGATACCCGGGCAGCGCGCTGTAGT-3′Adds HA tag to gD1
P75′-GATCGGATCCATGCGGAGGCTGGCGCTGCT-3′Amplification of gD5 ORF fused to V5
P85′-GATCAAGCTTTCACGTAGAATCGAGACCGAGGAGAGGGTTAGGGATAGGCTTACCCCCGGGCAGCGCGCTGTAGT-3′Adds V5 tag to gD5
  • Verification Methods:

    • Restriction enzyme analysis and Southern blotting to confirm correct integration.

    • PCR with specific primers spanning the integration sites.

    • Sequencing to confirm the absence of unwanted mutations .

How effective are recombinant gD-based vaccines against BoHV-1 and BoHV-5, and what adjuvant formulations have been most successful?

The effectiveness of recombinant gD-based vaccines against BoHV-1 and BoHV-5 varies based on formulation and adjuvant selection:

  • Subunit Vaccines:

    • Secreted form of gD (tgD) produced in mammalian cells and formulated with various adjuvants has shown strong protection.

    • When combined with CpG oligodeoxynucleotides (ODN) and the oil-based adjuvant Emulsigen, significantly stronger immune responses were achieved even with reduced antigen doses .

  • DNA Vaccines:

    • DNA vaccines encoding gD induce strong cell-mediated immune responses but generally weaker humoral responses.

    • Delivery methods like gene gun delivery of gD in combination with bovine IL-6 induced balanced immune responses .

  • Vectored Vaccines:

    • Human adenovirus 5 (HAdV-5) expressing gD under the control of the HCMV immediate-early promoter/enhancer has shown promising results.

    • A single intranasal immunization with HAdV-5 expressing gD elicited high titers of neutralizing antibodies.

    • This vector expressing gC and gD induced virus neutralizing antibodies and clinically protected cattle from BoHV-1 challenge after intranasal administration .

  • Adjuvant Comparison Study:
    A comprehensive study with 72 heifers evaluated different formulations:

    GroupVaccine FormulationImmune ResponseProtection
    1Inactivated BoHV-5 (iBoHV-5) with ISA50V2ModerateModerate
    2iBoHV-5 + 100 μg rgD5 with ISA50V25-fold increase in total IgG; 4-fold higher neutralizing antibody titersStrong
    3100 μg rgD5 with ISA50V2Significant increase in IgG1 and IgG2aGood
    4100 μg rgD5 with Al(OH)₃ModerateModerate
    5Commercial vaccineBaseline comparisonVariable
    6ControlNoneNone

    The study demonstrated that vaccines formulated with iBoHV-5 plus rgD5 adjuvanted with ISA50V2 provided the strongest immune responses, including cross-neutralization of both BoHV-1 and BoHV-5 .

What methods can be used to analyze interspecific recombination between BoHV-1 gD and related alphaherpesviruses?

Analyzing interspecific recombination between BoHV-1 gD and related alphaherpesviruses requires sophisticated methodological approaches:

  • Coinfection Experimental Design:

    • Create a system where two viruses can be distinguished after recombination.

    • Example: Using a double-deleted mutant of BoHV-1 containing green fluorescent protein (GFP) and red fluorescent protein (RFP) genes coinfected with different ruminant alphaherpesviruses .

  • Recombination Detection Methods:

    • Fluorescent Marker Tracking: After recombination, progeny viruses can be classified as parental (GFP⁺/RFP⁺ or GFP⁻/RFP⁻) or recombinant (GFP⁺/RFP⁻ or GFP⁻/RFP⁺) .

    • Restriction Enzyme Profile Analysis: Distinct patterns can identify the genetic background of recombinants .

    • Monoclonal Antibody Recognition: Using virus-specific monoclonal antibodies to detect antigenic differences .

  • Quantitative Analysis Methods:

    • Plaque Isolation and Characterization: Individual plaques are isolated, propagated, and characterized using confocal microscopy to determine recombination frequency .

    • Viral Growth Analysis: Comparing growth kinetics of parental and recombinant viruses at different MOIs (multiplicity of infection) .

    • Penetration Kinetics: Using low-pH inactivation of extracellular virions at different times after infection to assess changes in cell entry .

  • Sequence Analysis:

    • Homology Assessment: Using programs like Stretcher to find the best global alignment between sequences .

    • Phylogenetic Analysis: To determine evolutionary relationships between recombinant and parental viruses .

Research has shown that recombination frequency varies based on genetic relatedness: frequent recombination events (up to 30%) occur between identical or different strains of BoHV-1, whereas only rare recombinants between BoHV-1 and BoHV-5 were identified, and no recombinants between BoHV-1 and less closely related caprine and cervine herpesviruses were detected .

How can recombinant gD be optimized for diagnostic applications in detecting BoHV-1 infection?

Optimization of recombinant gD for diagnostic applications involves several methodological considerations:

What are the key experimental design considerations when evaluating immune responses to recombinant BoHV-1 gD in animal models?

When designing experiments to evaluate immune responses to recombinant BoHV-1 gD in animal models, researchers should consider the following methodological aspects:

  • Animal Model Selection:

    • Natural Host: Cattle are the primary natural host and provide the most relevant model, but experiments are costly and require specialized facilities.

    • Laboratory Animals: Mice and rabbits are commonly used for preliminary studies but may not fully recapitulate the immune response in cattle.

    • AR129 Mice: Have been used specifically for neurovirulence studies with BoHV recombinants .

  • Immunization Protocol Design:

    • Dosing Schedule: Typically involves primary immunization followed by one or more booster doses.

    • Example Protocol: A study with cattle used two doses administered at a 26-day interval with a third dose after 357 days from primo vaccination .

    • Route of Administration: Intramuscular, subcutaneous, intranasal, and other routes may produce different immune responses.

  • Immune Response Assessment:

    • Humoral Immunity Measurements:

      • Total antibody levels (ELISA)

      • Neutralizing antibody titers (virus neutralization test)

      • Antibody isotype determination (IgG1, IgG2a) for Th1/Th2 balance assessment

    • Cell-Mediated Immunity Measurements:

      • Delayed-type hypersensitivity (DTH) responses

      • Cytotoxic T lymphocyte (CTL) assays

      • Cytokine profiling (IFN-γ, IL-4, etc.)

  • Challenge Studies Design:

    • Timing: Usually performed 2-4 weeks after final immunization.

    • Route: Should mimic natural infection (often intranasal for respiratory disease).

    • Assessment Parameters:

      • Clinical signs scoring

      • Virus shedding quantification

      • Body temperature monitoring

      • Weight gain/loss tracking

  • Control Groups:

    • Negative Control: Unvaccinated animals

    • Positive Control: Animals receiving commercial vaccine

    • Adjuvant Control: Animals receiving adjuvant without antigen

How do differences in the C-terminal region of BoHV-1 and BoHV-5 gD affect receptor binding and viral tropism?

The differences in the C-terminal region of BoHV-1 and BoHV-5 gD significantly impact receptor binding and viral tropism:

What methodological approaches address the stability challenges of recombinant gD when used in subunit vaccines?

Subunit vaccines containing recombinant gD face stability challenges that researchers have addressed through various methodological approaches:

What techniques are used to analyze the critical epitopes of BoHV-1 gD important for neutralizing antibody production?

Understanding the critical epitopes of BoHV-1 gD that elicit neutralizing antibodies requires sophisticated analytical techniques:

  • Epitope Mapping Approaches:

    • Peptide Scanning: Synthesis of overlapping peptides spanning the gD sequence and testing their reactivity with neutralizing antibodies.

    • Phage Display: Selection of peptide mimotopes from phage libraries using neutralizing monoclonal antibodies.

    • Site-directed Mutagenesis: Systematic alteration of specific amino acids to identify critical residues.

  • Structural Analysis Methods:

    • X-ray Crystallography: Determination of three-dimensional structure, particularly of gD complexed with neutralizing antibodies or receptors.

    • Cryo-electron Microscopy: Analysis of gD structure in its native context within the virion.

    • Molecular Modeling: Computational prediction of epitopes based on structural data and sequence analysis.

  • Functional Assays:

    • Neutralization Inhibition Assays: Competition between peptides and virus for antibody binding.

    • Receptor Binding Inhibition: Identifying epitopes that block interaction with cellular receptors.

    • Cell Fusion Assays: Evaluating the impact of antibodies on gD-mediated membrane fusion.

  • Impact of Glycosylation Analysis:

    • Research has shown that most functional epitopes on gD are carbohydrate-independent, as deglycosylated gD maintained the ability to induce neutralizing antibodies and antibody-dependent cell-mediated cytotoxicity despite lower total antibody responses .

    • N-glycosylation sites were found to be present at amino acid positions 41 and 102 .

  • Cross-neutralization Studies:

    • Comparison of neutralizing activity against BoHV-1 and related viruses (BoHV-5, CpHV-1, etc.) to identify conserved neutralizing epitopes.

    • Recombinant BoHV-5 gD was found to conserve important epitopes that stimulated bovine humoral immunity capable of viral neutralization of both BoHV-1 and BoHV-5 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.