Recombinant Bovine Hyaluronan synthase 2 (HAS2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Bovine Hyaluronan Synthase 2 (HAS2)

Recombinant Bovine Hyaluronan Synthase 2 (HAS2) is a genetically engineered enzyme responsible for synthesizing high-molecular-weight hyaluronan (HA), a critical glycosaminoglycan in extracellular matrix (ECM) formation. This enzyme plays essential roles in tissue hydration, cell migration, and developmental processes such as cardiac morphogenesis and wound healing . Recombinant versions enable standardized studies and therapeutic applications by ensuring controlled expression and purity.

Key Features of Recombinant Bovine HAS2:

PropertyValue/Detail
Molecular Weight63,459 Da
UniProt IDO97711
Gene ID281220 (NCBI)
Catalytic FunctionAdds GlcNAc/GlcUA to HA polymers
Subcellular LocationMulti-pass membrane protein
Detection Range (ELISA)0.156–10 ng/mL
Sensitivity (ELISA)0.066 ng/mL

Recombinant bovine HAS2 is expressed in systems like HEK cells for functional studies, with codon optimization (e.g., GenBank XM 539153.3) enhancing expression efficiency in target species .

HA Synthesis and ECM Regulation

  • Produces high-molecular-weight HA (>1.5 MDa), essential for ECM structural integrity and cell signaling .

  • Critical in cardiac development: Has2 knockout mice exhibit severe cardiac defects due to impaired endothelial-to-mesenchymal transition .

Disease Associations

  • Liver Fibrosis: Upregulated in activated hepatic stellate cells (HSCs), driving HA accumulation and fibrosis progression. siRNA-mediated HAS2 knockdown reduces ECM deposition .

  • Osteoarthritis: Reduced HAS2 activity correlates with synovial fluid viscosity loss. Recombinant adeno-associated virus (rAAV)-mediated HAS2 delivery restores HA synthesis in canine joints .

Gene Therapy for Joint Disorders

  • rAAV Vectors: Delivery of codon-optimized HAS2 into dog joints increased HA synthesis by 6.5–9-fold in vitro .

  • Outcomes: Restored HA viscosity and reduced proteoglycan loss in osteoarthritis models .

Antifibrotic Strategies

  • siRNA Targeting: HAS2 suppression reduces HA-driven fibrotic markers (e.g., collagen I, α-SMA) by 35–45% in TGF-β-activated HSCs .

  • Pharmacological Inhibition: 4-methylumbelliferone (4MU) blocks HA synthesis, mitigating inflammation in liver fibrosis .

In Vitro HA Production Post-HAS2 Transfection

ConditionHA Concentration (vs. Control)Molecular Weight
HEK Cells + cHAS2 Plasmid6.5–9x higher>1.5 MDa
HEK Cells + EGFP PlasmidNo changeN/A

Data source: rAAV-mediated cHAS2 expression in HEK cells

Regulation by miRNAs

  • miR-200c: Directly targets HAS2 3’UTR, inversely expressed in fibrotic livers. Overexpression reduces HA synthesis and inflammation .

Challenges and Future Directions

  • HA Molecular Weight Dynamics: Balancing high- vs. low-molecular-weight HA effects remains complex, as LMW-HA promotes inflammation .

  • Delivery Optimization: Improving rAAV vector tropism for joint-specific HAS2 expression requires further study .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HAS2; Hyaluronan synthase 2; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-552
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
HAS2
Target Protein Sequence
MHCERFLCILRIIGTTLFGVSLLLGITAAYIVGYQFIQTDNYYFSFGLYGAFLASHLIIQ SLFAFLEHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVI DGNSEDDLYMMDIFSEVMGRDKSATYIWKNNYHVKGPGETDESHKESSQHVTQLVLSNKS ICTMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGG DVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWY NQEFMGSQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFR EWLYNAMWFHKHHLWMTYEAVITGFFPFFLIATVIQLFYRGKIWNTLLFLLTVQLVGLIK SSFASCLRGNIVMVFMSLYSVLYMSSLLPAKMFAIATINKAGWGTSGRKTIVVNFIGLIP VSVWFTILLGGVIFTIYKESKKPFSESKQTVLIVGTLLYACYWVMLLTLYVVLINKCGRR KKGQQYDMVLDV
Uniprot No.

Target Background

Function
Recombinant Bovine Hyaluronan synthase 2 (HAS2) catalyzes the addition of GlcNAc or GlcUA monosaccharides to nascent hyaluronan polymers. This enzyme is essential for hyaluronan synthesis, a crucial component of most extracellular matrices. Hyaluronan plays a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. HAS2 is an isozyme responsible for synthesizing high molecular weight hyaluronan. It is required for the endocardial cushion cell-to-mesenchymal cell transition, vital for heart development, and may also participate in vasculogenesis. High molecular weight hyaluronan contributes to early contact inhibition, a process that halts cell growth upon cell-cell or cell-extracellular matrix contact.
Database Links
Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in corneal endothelial cells.

Q&A

What is Hyaluronan Synthase 2 (HAS2) and its biological significance?

Hyaluronan synthase 2 (HAS2) is a member of the vertebrate gene family encoding putative hyaluronan synthases, responsible for producing hyaluronic acid (HA). HA is a high molecular weight unbranched polysaccharide consisting of alternating glucuronic acid and N-acetylglucosamine residues linked by beta-1-3 and beta-1-4 glycosidic bonds. This molecule serves multiple biological functions including space filling, joint lubrication, and providing a matrix through which cells can migrate .

HAS2 is a membrane-bound synthase that catalyzes HA production at the inner surface of the plasma membrane, with the chains being extruded through pore-like structures into the extracellular space. The enzyme plays a crucial role in wound healing and tissue repair by providing a framework for blood vessel and fibroblast ingrowth. Additionally, HA interactions with leukocyte receptor CD44 contribute to tissue-specific homing of leukocytes, while overexpression of HA receptors has been correlated with tumor metastasis .

HAS2's significance extends to various physiological processes, particularly in fibrotic responses during wound healing, as demonstrated in bovine keratocytes where rapid induction of HA expression suggests a functional role of this molecule in the fibrotic response .

What are the structural and functional differences between bovine HAS2 and its human counterpart?

Bovine HAS2 shares significant homology with human HAS2, as both belong to the same enzyme family responsible for HA synthesis. The structural similarities between species allow researchers to use bovine models to study fundamental aspects of HAS2 function that may be applicable across mammalian systems.

Both bovine and human HAS2 are transmembrane proteins with similar domain organization, including the Glycos_transf_2 (glycosyltransferase 2) domain that is critical for enzymatic activity . The protein structure includes multiple transmembrane segments that anchor the enzyme to the plasma membrane, facilitating the extrusion of newly synthesized HA chains into the extracellular space.

Functionally, both bovine and human HAS2 respond to growth factors and cytokines, though the magnitude and temporal patterns of response may differ between species. Research has shown that in bovine keratocytes, HAS2 mRNA increases rapidly in response to TGFβ stimulation, peaking at 4-6 hours before returning to baseline levels within 24 hours . This temporal expression pattern is likely similar in human cells, though species-specific differences in regulatory elements may result in varied expression kinetics.

How is HAS2 expression regulated in bovine cells?

HAS2 expression in bovine cells, particularly keratocytes, is subject to complex regulatory mechanisms that respond to various stimuli. Research has demonstrated that HAS2 mRNA levels can be rapidly and transiently increased in response to transforming growth factor-beta (TGFβ) and various mitogens .

In bovine keratocytes, HAS2 mRNA increases more than 50-fold within 4-6 hours of TGFβ stimulation, followed by a return to near-original levels after 24-48 hours. This indicates a tightly controlled temporal regulation mechanism. Notably, TGFβ can act synergistically with other mitogens to induce HAS2 expression by as much as 150-fold .

The regulation appears to be primarily at the transcriptional level, though post-transcriptional mechanisms may also contribute to controlling HAS2 expression. Additionally, the induction of HAS2 expression correlates directly with increased HA production, which peaks approximately 12 hours after stimulation and decreases thereafter, indicating a direct functional relationship between gene expression and enzymatic activity .

HA biosynthesis is not detected when keratocytes are cultured in serum-free medium, but exposure to FBS (fetal bovine serum) for 6 days induces HA production to approximately 1% of the total glycosaminoglycan content. This percentage increases to about 5% in the presence of both TGFβ and serum, demonstrating the synergistic effects of growth factors and serum components on HAS2 regulation .

What are the optimal methods for cloning and expressing recombinant bovine HAS2?

Cloning and expressing recombinant bovine HAS2 requires careful consideration of vector design, host selection, and expression conditions. Based on successful approaches with HAS2 from other species, the following methodological approach is recommended:

Vector Selection: Adenoviral vectors have proven effective for HAS2 expression, as demonstrated in studies with human and murine HAS2. For bovine HAS2, similar vector systems can be employed, with selection between CMV-driven constitutive expression or inducible systems such as Tet-On depending on experimental requirements .

Cloning Strategy:

  • Isolate full-length bovine HAS2 cDNA from bovine tissue (e.g., corneal keratocytes) using RT-PCR

  • Incorporate appropriate restriction sites for directional cloning

  • Consider adding epitope tags (such as Myc-DDK or GFP) for detection and purification

  • Clone the sequence into expression vectors using standard molecular biology techniques

Expression System Options:

  • Mammalian cell expression (HEK293, CHO cells) for proper post-translational modifications

  • Baculovirus-insect cell systems for higher protein yields

  • Bacterial systems may be less suitable due to the transmembrane nature of HAS2

Optimization Parameters:

  • Transfection/transduction efficiency (aim for ~50% as demonstrated in similar studies)

  • Expression temperature (typically 37°C for mammalian cells)

  • Induction parameters if using inducible systems

  • Harvest timing based on expression kinetics

For visualization and tracking, GFP fusion constructs (such as ZsGreen) can be incorporated into the expression system. For controlled expression, doxycycline-inducible promoters have proven effective with HAS2 genes .

How can siRNA technology be utilized to study bovine HAS2 function?

Small interfering RNA (siRNA) technology offers powerful tools for studying bovine HAS2 function through targeted knockdown approaches. Research has demonstrated that siRNA against HAS2 can effectively inhibit the transient increase of HAS2 mRNA and completely block HA induction in response to stimuli such as TGFβ .

Methodological approach for siRNA studies of bovine HAS2:

  • siRNA Design:

    • Target unique regions of bovine HAS2 mRNA sequence

    • Design multiple siRNA candidates (typically 3-4) targeting different regions

    • Include appropriate negative controls (non-targeting siRNA) and positive controls (siRNA targeting a housekeeping gene)

  • Delivery Methods:

    • Lipid-based transfection for primary bovine cells

    • Electroporation for hard-to-transfect cells

    • Viral vector-mediated delivery for sustained knockdown

  • Validation of Knockdown:

    • Quantitative RT-PCR to measure HAS2 mRNA levels

    • Western blotting if antibodies are available

    • Functional assays measuring HA production

  • Experimental Design:

    • Determine optimal siRNA concentration (typically 10-50 nM)

    • Establish appropriate time points for analysis based on HAS2 expression kinetics

    • Include appropriate stimulation conditions (e.g., TGFβ treatment)

Critical considerations include specificity validation to ensure that the observed effects are due to HAS2 knockdown rather than off-target effects. Comparing results from multiple siRNA sequences targeting different regions of HAS2 can help confirm specificity. Research has shown that while siRNA against HAS2 blocks HA induction, siRNA targeting HAS1 has no effect on HA secretion in bovine keratocytes, highlighting the importance of isoform-specific targeting .

What techniques can measure the enzymatic activity of recombinant bovine HAS2?

Measuring the enzymatic activity of recombinant bovine HAS2 requires techniques that can quantify hyaluronic acid (HA) production under controlled conditions. Several complementary methods can be employed:

  • Radiometric Assay:

    • Incorporate radiolabeled UDP-sugars (UDP-[14C]GlcUA and UDP-[3H]GlcNAc) as substrates

    • Measure incorporation into high molecular weight HA

    • Quantify by scintillation counting after separation from unincorporated precursors

  • ELISA-Based Methods:

    • Use HA-binding proteins (such as aggrecan G1 domain or HABP2) as capture reagents

    • Employ biotinylated HA-binding proteins for detection

    • Quantify against a standard curve of purified HA

  • Fluorescence-Based Assays:

    • Use fluorescein-labeled HA to monitor degradation or turnover

    • As demonstrated in bovine keratocyte studies, TGFβ treatment induces degradation of fluorescein-HA added to culture medium

    • Measure fluorescence intensity changes to quantify activity

  • Size-Exclusion Chromatography:

    • Separate newly synthesized HA by molecular weight

    • Quantify using refractive index or multi-angle light scattering detection

    • Particularly useful for determining the size distribution of synthesized HA

  • Metabolic Labeling in Cell Culture:

    • Supplement culture medium with isotopically labeled precursors

    • Isolate and purify secreted HA

    • Quantify incorporation using mass spectrometry

When designing enzymatic assays, it's essential to consider the temporal dynamics of HAS2 activity. Research in bovine keratocytes has shown that HA synthesis peaks approximately 12 hours after stimulation with TGFβ, following the peak of HAS2 mRNA expression at 4-6 hours . This temporal offset between mRNA expression and maximal enzymatic activity should be factored into experimental timelines.

How does TGFβ signaling affect bovine HAS2 expression and activity?

Transforming growth factor-beta (TGFβ) signaling plays a crucial role in regulating bovine HAS2 expression and activity through multiple mechanisms. Research on bovine keratocytes has revealed detailed insights into this regulatory pathway.

TGFβ induces a rapid and transient increase in HAS2 mRNA levels in bovine keratocytes, with expression increasing more than 50-fold within 4-6 hours of stimulation before returning to near-baseline levels after 24-48 hours . This temporal pattern suggests tightly regulated transcriptional control of the HAS2 gene in response to TGFβ signaling.

The signaling pathway appears to involve canonical TGFβ receptor activation, as demonstrated by the following observations:

  • Temporal Expression Pattern:

    • HAS2 mRNA rapidly increases, peaking at 4-6 hours

    • HA synthesis follows, peaking at approximately 12 hours

    • Both mRNA and HA production decrease thereafter, returning to baseline by 24-48 hours

  • Synergistic Effects:

    • TGFβ acts synergistically with various mitogens to enhance HAS2 expression

    • Combined stimulation can increase HAS2 mRNA levels by as much as 150-fold

    • In the presence of both TGFβ and serum, HA production increases to about 5% of total glycosaminoglycan content (compared to 1% with serum alone)

  • Dual Regulation of HA Metabolism:

    • TGFβ not only induces HAS2 expression and HA synthesis

    • It also triggers degradation of existing HA in the extracellular environment

    • This was demonstrated using fluorescein-labeled HA added to culture medium

This bidirectional control of HA levels (both synthesis and degradation) suggests that TGFβ orchestrates a comprehensive remodeling of the HA-rich extracellular matrix rather than simply increasing HA production. This may be particularly relevant in wound healing and fibrotic responses, where matrix remodeling is critical.

What are the optimal conditions for studying recombinant bovine HAS2 in vitro?

Establishing optimal conditions for studying recombinant bovine HAS2 in vitro requires careful consideration of multiple experimental parameters:

  • Cell Culture System Selection:

    • Primary bovine keratocytes provide a physiologically relevant system

    • Established cell lines (e.g., bovine corneal endothelial cells) offer greater consistency

    • Heterologous expression systems (HEK293, CHO) may be used for specific applications

  • Culture Medium Composition:

    • Serum conditions significantly impact HAS2 expression and activity

    • Serum-free conditions show minimal HA biosynthesis

    • FBS supplementation (10%) induces moderate HA production

    • Combined TGFβ and serum maximizes HA production

  • Growth Factor Supplementation:

    • TGFβ (typically 2-10 ng/ml) for maximal HAS2 induction

    • Other mitogens can be used for synergistic effects

    • Consider time-course experiments to capture the transient nature of HAS2 expression

  • Transduction/Transfection Parameters:

    • For viral transduction, optimization to achieve ~50% efficiency is recommended

    • MOI (multiplicity of infection) titration is essential for adenoviral systems

    • For plasmid transfection, lipid-based methods are typically effective

  • Experimental Timeline Considerations:

    • HAS2 mRNA peaks at 4-6 hours post-stimulation

    • HA production peaks at approximately 12 hours

    • Return to baseline occurs by 24-48 hours

    • Design sampling timepoints accordingly

When using inducible expression systems, such as the Tet-On doxycycline-inducible promoter described for HAS2 expression, careful titration of the inducer is necessary to achieve desired expression levels . For visualization purposes, incorporating reporter genes such as GFP (ZsGreen) can facilitate monitoring of transduction efficiency and expression patterns.

Temperature, pH, and osmolarity should be maintained at physiological levels (37°C, pH 7.2-7.4) unless specifically investigating the effects of these parameters on HAS2 activity.

What are the common challenges in expressing functional recombinant bovine HAS2 and their solutions?

Expressing functional recombinant bovine HAS2 presents several challenges that researchers should anticipate and address:

  • Transmembrane Protein Expression Challenges:

    • HAS2 is a membrane-bound synthase with multiple transmembrane domains

    • Solution: Use mammalian expression systems that properly process transmembrane proteins

    • Consider including specific membrane-targeting sequences if necessary

  • Plasmid Stability Issues:

    • Expression plasmids for genes like HAS2 may be prone to mutations/rearrangements during replication

    • Solution: Verify sequence integrity before use and consider purchasing new batches of verified plasmid for critical experiments rather than multiple rounds of amplification

  • Variable Expression Levels:

    • Expression can vary depending on the nature of the gene and construct design

    • Solution: Optimize codon usage for bovine systems and include enhancer elements if necessary

  • Protein Detection Challenges:

    • Transmembrane proteins can be difficult to detect by conventional methods

    • Solution: Incorporate epitope tags (e.g., Myc-DDK tag or GFP tag) to facilitate detection and purification

  • Enzymatic Activity Verification:

    • Confirming that the recombinant protein retains enzymatic activity

    • Solution: Implement functional assays measuring HA production and compare with native enzyme activity

  • Transduction Efficiency:

    • Achieving consistent and sufficient transduction rates

    • Solution: Optimize viral titers and transduction protocols to achieve ~50% efficiency as demonstrated in similar studies

  • Temporal Expression Control:

    • HAS2 shows complex temporal expression patterns that may be difficult to reproduce

    • Solution: Use inducible expression systems (e.g., Tet-On) for precise temporal control

  • Off-Target Effects of Overexpression:

    • HAS2 overexpression may alter cellular physiology beyond HA production

    • Solution: Include appropriate controls and consider dose-dependent expression studies

When troubleshooting expression issues, systematic optimization of each parameter (vector design, host cell type, culture conditions, induction protocol) is recommended. For recalcitrant expression problems, alternative approaches such as using different promoters, signal sequences, or host cell types should be considered.

How can researchers evaluate the biological effects of recombinant bovine HAS2 overexpression?

Evaluating the biological effects of recombinant bovine HAS2 overexpression requires a multi-faceted approach examining both direct enzymatic activity and downstream cellular consequences:

  • Quantification of HA Production:

    • Measure HA concentration in culture medium using ELISA or other quantitative methods

    • Analyze molecular weight distribution of synthesized HA using size exclusion chromatography

    • Compare production rates with control cells expressing normal HAS2 levels

  • Extracellular Matrix Changes:

    • Visualize pericellular HA using particle exclusion assays or histochemical staining

    • Examine interactions with other matrix components (e.g., proteoglycans)

    • Assess matrix mechanical properties using rheological measurements

  • Cell Behavior Alterations:

    • Monitor changes in cell morphology, adhesion, and cytoskeletal organization

    • Measure proliferation rates and cell cycle distribution

    • Assess migration behavior using wound healing or transwell assays

    • Evaluate resistance to apoptotic stimuli

  • Molecular Signaling Effects:

    • Analyze CD44 and RHAMM receptor expression and distribution

    • Examine activation of downstream signaling pathways (e.g., ERK, Akt)

    • Investigate changes in gene expression profiles using RNA-seq or microarray

  • Functional Consequences in Tissue-Specific Contexts:

    • For bovine keratocytes, assess fibrotic response markers

    • Measure contractile properties of cell-populated collagen lattices

    • Evaluate wound healing responses in scratch assays

Research has demonstrated that HAS2 overexpression can have significant biological effects. For example, studies have explored using adenoviral vectors to overexpress HAS2 in articular chondrocytes to replenish HA at the cell surface and in the extracellular environment . The approach of using viral vectors with either constitutive or inducible promoters allows for controlled expression to study dose-dependent effects of HAS2 activity.

When evaluating biological effects, it's important to consider that HAS2 overexpression may have different consequences depending on the cell type and microenvironment. Comparing results across multiple experimental systems can provide more comprehensive insights into the biological roles of HAS2.

How should researchers interpret temporal changes in HAS2 expression patterns?

Interpreting temporal changes in HAS2 expression requires careful consideration of the complex regulatory mechanisms controlling both gene expression and enzymatic activity:

  • mRNA vs. Protein Expression Timeline:

    • HAS2 mRNA shows rapid but transient increases, peaking at 4-6 hours after stimulation

    • This is followed by HA production peaking at approximately 12 hours

    • Both return to baseline within 24-48 hours

    • The offset between peak mRNA and peak enzymatic activity reflects the time required for translation, protein maturation, and establishment of enzymatic activity

  • Expression Magnitude Analysis:

    • Fold-change in HAS2 mRNA can be dramatic (>50-fold with TGFβ, up to 150-fold with synergistic stimulation)

    • These large changes suggest that baseline HAS2 expression is tightly suppressed and that the gene is highly responsive to specific stimuli

    • The magnitude of increase may vary between experimental systems and should be calibrated accordingly

  • Correlation with Biological Responses:

    • The rapid induction of HAS2 expression in keratocytes suggests its role as an early response gene in the fibrotic pathway

    • The transient nature of the response indicates that HA production is precisely controlled rather than constitutively active

    • This temporal pattern is consistent with HA's role in early wound healing and tissue repair processes

  • Regulatory Feedback Mechanisms:

    • The return to baseline levels after 24-48 hours suggests negative feedback mechanisms

    • The concurrent induction of HA degradation by TGFβ indicates a comprehensive regulation of HA homeostasis

    • These observations support a model where HAS2 initiates a pulse of HA production that is subsequently modulated by degradative processes

When interpreting temporal data, researchers should consider the physiological context of HAS2 activation. In wound healing, for example, the rapid but transient increase in HAS2 expression may provide an initial HA-rich environment conducive to cell migration and proliferation, while the subsequent decrease prevents excessive matrix accumulation that could lead to fibrosis or scarring.

What is the significance of HAS2 in regenerative medicine and tissue engineering applications?

HAS2 plays a critical role in regenerative medicine and tissue engineering applications due to its control over hyaluronic acid (HA) production, a key extracellular matrix component with numerous beneficial properties:

  • Wound Healing Enhancement:

    • HAS2 is actively produced during wound healing to provide a framework for ingrowth of blood vessels and fibroblasts

    • The temporal pattern of expression (rapid increase followed by controlled decrease) appears optimized for effective tissue repair

    • Manipulating HAS2 expression could potentially accelerate healing processes

  • Scaffold Development:

    • HA produced by HAS2 serves as a natural biological scaffold

    • Its hydrophilic properties create a hydrated environment conducive to cell migration

    • The high molecular weight of newly synthesized HA provides appropriate mechanical properties for tissue support

  • Cell Behavior Modulation:

    • HA interactions with CD44 and other cell surface receptors influence cell adhesion, migration, and differentiation

    • These properties can be harnessed to guide cellular behavior in engineered tissues

    • The space-filling and lubrication functions of HA are particularly valuable in joint and cartilage applications

  • Inflammation Control:

    • Changes in HA concentration are associated with inflammatory conditions

    • Understanding HAS2 regulation may provide insights into controlling inflammation in engineered tissues

    • The interaction of HA with leukocyte receptor CD44 influences tissue-specific homing, relevant for immune response in implanted constructs

  • Cartilage Engineering Applications:

    • Research has explored HAS2 overexpression to replenish HA at the surface of chondrocytes and within the extracellular environment

    • Adenoviral vector-based approaches have been developed for controlled HAS2 expression in chondrocytes

    • These approaches could potentially address issues in cartilage regeneration and osteoarthritis treatment

The ability to control HAS2 expression through viral vectors with either constitutive or inducible promoters offers significant potential for regenerative applications. For instance, the development of Tet-On doxycycline-inducible promoters to selectively drive HAS2 protein transcription provides precise temporal control over HA production, potentially allowing for targeted intervention at specific stages of the healing process .

How does bovine HAS2 research contribute to understanding human disease mechanisms?

Research on bovine HAS2 contributes significantly to understanding human disease mechanisms through comparative biology and model system approaches:

  • Fibrosis and Wound Healing Disorders:

    • The rapid transient increase in HAS2 mRNA in bovine keratocytes in response to TGFβ provides insights into the molecular mechanisms of fibrosis

    • This model helps explain the initial stages of both normal wound healing and pathological fibrotic conditions

    • The finding that HAS2 (rather than HAS1) is primarily responsible for HA production in this context helps focus therapeutic targeting efforts

  • Inflammatory and Degenerative Arthropathies:

    • Changes in serum HA concentration are associated with inflammatory and degenerative arthropathies such as rheumatoid arthritis

    • Understanding the regulation of HAS2 in bovine models provides insights into these conditions

    • The role of TGFβ in regulating both HA synthesis and degradation may be particularly relevant to joint pathologies

  • Cancer Metastasis Mechanisms:

    • Overexpression of HA receptors has been correlated with tumor metastasis

    • Research on HAS2 regulation helps explain how increased HA production may contribute to cancer progression

    • The finding that specific inhibition of HAS2 can block HA induction suggests potential therapeutic approaches

  • Cartilage Disorders:

    • Studies on HAS2 overexpression in chondrocytes directly address mechanisms relevant to cartilage disorders

    • Approaches to replenish HA at the surface of chondrocytes and within the extracellular environment have therapeutic implications

    • Viral vector systems developed for bovine and other species' HAS2 provide potential delivery mechanisms for human therapies

  • Comparative Molecular Pathology:

    • The high degree of conservation in HAS enzymes across species allows bovine findings to inform human disease mechanisms

    • Differences in regulatory elements and expression patterns between species can highlight evolutionarily conserved (and thus potentially more critical) aspects of HAS2 function

    • These comparative insights help prioritize targets for therapeutic intervention

By studying the molecular mechanisms of HAS2 regulation in bovine systems, researchers gain insights applicable to human conditions characterized by altered HA metabolism. The siRNA approaches successfully used to inhibit bovine HAS2 also suggest potential RNA-based therapeutic strategies for human diseases involving HAS2 dysregulation.

What are the future directions for recombinant bovine HAS2 research?

The field of recombinant bovine HAS2 research is poised for significant advances in several key directions:

  • Systems Biology Integration:

    • Moving beyond isolated study of HAS2 to understand its place in broader regulatory networks

    • Integration of transcriptomic, proteomic, and metabolomic data to create comprehensive models of HA metabolism

    • Investigation of species-specific differences in HAS2 regulation between bovine and human systems

  • Advanced Expression Systems:

    • Development of improved viral and non-viral vectors for precise spatial and temporal control of HAS2 expression

    • Exploration of tissue-specific promoters for targeted expression in regenerative medicine applications

    • Creation of stable cell lines with inducible HAS2 expression for consistent experimental systems

  • Structure-Function Relationships:

    • Detailed structural characterization of bovine HAS2 to understand the catalytic mechanism

    • Investigation of post-translational modifications affecting enzymatic activity

    • Structure-based design of specific inhibitors or activators for experimental and therapeutic use

  • Translational Applications:

    • Development of bovine HAS2-based approaches for veterinary applications

    • Cross-species comparative studies to validate bovine findings in human systems

    • Exploration of recombinant HAS2 as a bioproduction system for high-quality HA

  • CRISPR/Cas9 Gene Editing:

    • Precise genomic modification of HAS2 regulatory elements to understand transcriptional control

    • Creation of reporter systems for real-time monitoring of HAS2 expression

    • Establishment of HAS2 knockout models to study compensatory mechanisms

The rapid advancement of genetic tools and protein expression systems will likely accelerate progress in understanding and manipulating HAS2 function. The successful approaches using adenoviral vectors with GFP reporters and inducible promoters provide a foundation for more sophisticated systems allowing precise control over when, where, and how much HAS2 is expressed in experimental and therapeutic contexts.

As our understanding of the temporal dynamics of HAS2 expression continues to improve , future research will likely focus on harnessing these natural regulatory mechanisms to develop interventions that more closely mimic physiological patterns of HA production for optimal therapeutic outcomes.

What are the most promising techniques for studying HAS2 in complex biological systems?

The study of HAS2 in complex biological systems requires sophisticated techniques that can capture its dynamic expression, localization, and activity in physiologically relevant contexts:

  • Single-Cell Transcriptomics:

    • Reveals cell-specific HAS2 expression patterns within heterogeneous tissues

    • Identifies subpopulations with differential HAS2 response to stimuli

    • Enables correlation of HAS2 expression with broader transcriptional programs

  • Live-Cell Imaging Systems:

    • Fluorescent reporter constructs for real-time monitoring of HAS2 expression

    • Visualization of HA production and deposition using fluorescently labeled HA-binding proteins

    • Tracking of cellular responses to HAS2 modulation in real-time

  • Spatial Transcriptomics:

    • Maps HAS2 expression within tissue architecture

    • Correlates expression with specific microenvironmental features

    • Provides insights into regulatory gradients affecting HAS2 transcription

  • Organ-on-Chip Technologies:

    • Creates physiologically relevant 3D microenvironments for studying HAS2 function

    • Enables controlled introduction of mechanical forces, flow, and cell-cell interactions

    • Allows for complex multi-cell type studies mimicking in vivo conditions

  • Combinatorial Genetic Perturbation:

    • CRISPR screens to identify regulators of HAS2 expression

    • Multiplexed siRNA approaches to study pathway interactions

    • Synthetic genetic circuits for precise control of HAS2 expression

  • Quantitative Glycomics:

    • Mass spectrometry-based approaches to analyze HA production and modification

    • Isotope labeling to track HA synthesis, secretion, and degradation kinetics

    • Structural analysis of HA produced under different conditions

  • Advanced Viral Vector Systems:

    • Improved transduction efficiency targeting specific cell populations

    • Inducible promoter systems for temporal control of expression

    • Dual-reporter systems to simultaneously track transduction and HAS2 activity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.