Recombinant Bovine Insulin-induced gene 1 protein (INSIG1)

Shipped with Ice Packs
In Stock

Description

Introduction to INSIG1

Insulin-induced gene 1 (INSIG1) is a transmembrane protein encoded by the INSIG1 gene, primarily localized in the endoplasmic reticulum (ER). It regulates cholesterol biosynthesis, lipogenesis, and glucose homeostasis by interacting with sterol-sensing domains of key metabolic enzymes and transcription factors. In ruminants, INSIG1 has been studied for its role in lipid metabolism, particularly in mammary tissue . Recombinant bovine INSIG1 refers to the engineered protein produced through heterologous expression systems, often used to study its functional mechanisms in dairy cattle.

Role in Milk Fat Synthesis

In buffalo mammary epithelial cells (BMECs), INSIG1 overexpression reduced triglyceride (TAG) content by downregulating genes critical for lipid synthesis:

  • INSIG2, SREBP, PPARG, SCD, GPAM, DGAT2, AGPAT6 .
    Conversely, INSIG1 knockdown increased TAG levels, suggesting its role as a negative regulator of milk fat synthesis .

GeneFunctionEffect of INSIG1 Overexpression
SREBPTranscription factor for lipogenesis↓ mRNA expression
PPARGAdipogenesis regulator↓ mRNA expression
DGAT2TAG biosynthesis enzyme↓ mRNA expression

Mechanisms in Lipid Metabolism

INSIG1 modulates lipid remodeling and cholesterol homeostasis:

  • SCAP Retention: Binds SCAP in the ER, blocking SREBP activation and lipid synthesis .

  • HMGCR Degradation: Triggers ubiquitination and proteasomal degradation of HMGCR, reducing cholesterol synthesis .

Recombinant INSIG1 Production Methods
Studies in ruminants employ lentiviral or adenoviral systems for INSIG1 overexpression or knockdown:

  • Lentivirus: Used in BMECs to achieve stable INSIG1 overexpression .

  • Adenovirus: Employed in goat mammary epithelial cells (GMECs) to transiently modulate INSIG1 levels .

Agricultural Biotechnology

  • Milk Fat Modulation: Manipulating INSIG1 could optimize milk fat composition in dairy cattle, enhancing nutritional value.

  • Lactation Efficiency: Overexpression may reduce energy expenditure on lipid synthesis during peak lactation .

Therapeutic Potential

  • NAFLD Models: INSIG1 deficiency in mice reduced liver cholesterol and improved lipid remodeling, suggesting its role in metabolic disorders .

  • Antiviral Strategies: In HIV-1 models, INSIG1 degrades Gag protein via TRC8-mediated lysosomal pathways, highlighting antiviral potential .

Key Challenges and Future Directions

  • Species-Specific Variations: Bovine INSIG1’s regulatory networks require further validation.

  • Recombinant Stability: Murine studies show INSIG1 is rapidly degraded via proteasomes; stabilizing mutations (e.g., S149R/A162S) may enhance utility .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please indicate your preference when placing your order, and we will prepare the protein accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. This can be used as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
INSIG1; Insulin-induced gene 1 protein; INSIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
INSIG1
Target Protein Sequence
MPRLDDHLWRGPCAKGTKHRSHPRASARGLVAKAGEMINSSGSGPSLLAAHGALGTDPAH GPQSAGVGGQGSSSHVNSWHHHLVQRSLVLFSVGVVLALVLNLLQVQRNVTLFPDEVIAT IFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCVAVFVGINHASAKL DFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQLLVYNGVYQYTSPDF LYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD
Uniprot No.

Target Background

Function
Insulin-induced gene 1 (INSIG1) is an oxysterol-binding protein that plays a crucial role in mediating feedback control of cholesterol synthesis. It achieves this by regulating both the endoplasmic reticulum to Golgi transport of SCAP and the degradation of HMGCR. INSIG1 acts as a negative regulator of cholesterol biosynthesis by mediating the retention of the SCAP-SREBP complex in the endoplasmic reticulum, thereby preventing the processing of sterol regulatory element-binding proteins (SREBPs) SREBF1/SREBP1 and SREBF2/SREBP2. INSIG1 binds to oxysterols, including 25-hydroxycholesterol, which modulates its interaction with SCAP and influences the retention of the SCAP-SREBP complex in the endoplasmic reticulum. In the presence of oxysterol, INSIG1 interacts with SCAP, effectively trapping the SCAP-SREBP complex within the endoplasmic reticulum, preventing SCAP from escorting SREBF1/SREBP1 and SREBF2/SREBP2 to the Golgi. When sterol levels are low, or when phosphorylation by PCK1 occurs, the oxysterol-binding affinity of INSIG1 is reduced. This disruption of the interaction between INSIG1 and SCAP facilitates the transport of the SCAP-SREBP complex to the Golgi. Subsequently, SREBF1/SREBP1 and SREBF2/SREBP2 undergo processing and nuclear translocation. INSIG1 also regulates cholesterol synthesis by influencing the degradation of HMGCR. It initiates the sterol-mediated ubiquitin-mediated endoplasmic reticulum-associated degradation (ERAD) of HMGCR through the recruitment of the reductase to the ubiquitin ligases AMFR/gp78 and/or RNF139. Furthermore, INSIG1 plays a regulatory role in the degradation of SOAT2/ACAT2 when lipid levels are low. It initiates the ubiquitin-mediated degradation of SOAT2/ACAT2 by recruiting the ubiquitin ligases AMFR/gp78.
Gene References Into Functions
  1. In Nanyang Chinese cattle, seven common haplotypes were identified in the INSIG1 gene based on four coding region SNPs. PMID: 22642648
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of INSIG1 in cellular metabolism?

INSIG1 functions as a crucial regulator of lipid metabolism by mediating the activation of sterol regulatory element-binding protein (SREBP) and controlling the degradation of HMG-CoA reductase (HMGCR). As an endoplasmic reticulum (ER) membrane protein, INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMGCR, serving as an essential component for sterol-mediated trafficking of these proteins .

The regulatory feedback mechanism involving INSIG1/SREBP1 represents an adaptive response that maintains white adipose tissue (WAT) lipid homeostasis, especially under conditions of metabolic stress. This adaptive mechanism helps preserve lipid desaturation through preferential stearoyl-CoA desaturase 1 (SCD1) regulation and facilitates fat storage in WAT despite ongoing metabolic challenges .

How does INSIG1 expression change in different metabolic states?

INSIG1 expression exhibits dynamic changes across different metabolic conditions. Studies have consistently demonstrated that Insig1 mRNA expression decreases in WAT from mice with obesity-associated insulin resistance and from morbidly obese humans . This downregulation appears to be part of an adaptive response that promotes the maintenance of SREBP1 maturation and facilitates lipogenesis, partially compensating for the antilipogenic effect associated with insulin resistance.

In experimental models, this pattern has been reproduced in 3T3-L1 adipocytes with induced insulin resistance, which show decreased levels of phosphorylated AKT, reduced Glut4 and Adiponectin mRNA, and recapitulate the changes in Srebp1 and Insig1 observed in vivo . This suggests that insulin resistance plays a primary mechanistic role in driving changes to both INSIG1 and SREBP1 expression levels.

What are the structural characteristics of the INSIG1 protein that determine its function?

INSIG1 is a six-transmembrane protein with both N and C termini facing the cytosol . It possesses several key structural motifs that contribute to its various functions:

  • The N-terminus of INSIG1 is longer than that of its paralog INSIG2, contributing to functional differences between these proteins .

  • Asp-205 represents a critical residue for mediating interaction with both SCAP and HMGCR .

  • The C-terminal five residues of INSIG1 form a motif (known as the KH motif) that interacts with coatomer for COPI-mediated Golgi-to-ER retrieval .

Interestingly, mutation studies investigating INSIG1's role in HIV-1 production found that alterations to these motifs did not affect INSIG1's ability to reduce HIV-1 Gag protein levels, suggesting that these structural features may not be involved in all INSIG1-mediated processes .

What are the established experimental models for studying INSIG1 function?

Several experimental models have been developed to investigate INSIG1 function across different contexts:

In vitro models:

  • 3T3-L1 preadipocytes and differentiated adipocytes: Used extensively to study INSIG1's role in adipogenesis and lipid metabolism .

  • Stable INSIG1 knockdown cell lines: Generated using RNA interference techniques to study the effects of INSIG1 downregulation on adipocyte differentiation and triglyceride content .

  • INSIG1 overexpression systems: Used to analyze the impact of increased INSIG1 levels on lipid accumulation and adipogenesis .

In vivo models:

  • INSIG1 knockout mouse: Generated by AstraZeneca Transgenics and Comparative Genomics for studying the physiological role of INSIG1 in metabolism .

  • Diet-induced obesity models: Utilized to study INSIG1 regulation under conditions of metabolic stress and insulin resistance .

Methodological approaches:

  • Dual-energy X-ray absorptiometry: Employed to measure body composition in INSIG1 knockout mice .

  • Oil-Red-O staining: Used to visualize lipid accumulation in adipocytes with altered INSIG1 expression .

  • Triglyceride content assays: Applied to quantify the impact of INSIG1 on lipid storage capacity .

How can researchers effectively generate and validate INSIG1 knockout models?

The generation and validation of INSIG1 knockout models require rigorous methodology to ensure specificity and reproducibility:

Generation techniques:

  • CRISPR/Cas9 approach: This has been successfully employed to generate insig1 knockout in both 293T and Jurkat cell lines . The technique requires careful guide RNA design targeting conserved exonic regions of the INSIG1 gene.

  • Traditional homologous recombination: Used for generating whole-organism knockout models, as demonstrated in the INSIG1 knockout mouse developed by AstraZeneca .

Validation methods:

  • Protein expression analysis: Western blotting to confirm complete absence of INSIG1 protein.

  • Functional validation: Measuring changes in lipid metabolism parameters, including:

    • Alterations in SREBP1 processing and maturation

    • Changes in lipogenic gene expression

    • Modifications to cellular lipid content and composition

  • Rescue experiments: Reintroduction of INSIG1 with a native promoter and synonymous encoding sequence to restore wild-type phenotype, confirming specificity of observed effects .

  • Phenotypic characterization: Assessment of metabolic parameters including:

    • Body composition analysis using dual-energy X-ray absorptiometry

    • Insulin sensitivity testing

    • Lipid profiling

Growth monitoring: Regular assessment of cell growth (in vitro) or animal development (in vivo) to detect any adverse effects of INSIG1 deletion. Studies have shown that knockout of insig1 had no obvious effect on the growth of Jurkat cells, suggesting minimal impact on basic cellular functions .

How does INSIG1 function change in pathological conditions like non-alcoholic fatty liver disease (NAFLD)?

INSIG1 plays a complex role in NAFLD pathogenesis that challenges conventional understanding of lipid metabolism in liver disease. Research using INSIG1-deficient mice challenged with a NASH-inducing diet has revealed several significant insights:

  • Lipidome remodeling: Despite enhanced lipid and cholesterol biosynthesis (which might be expected to worsen disease), INSIG1 knockout mice exhibit remodeling of the hepatic lipidome that appears protective .

  • Preserved metabolic parameters: Surprisingly, INSIG1-deficient mice maintain similar systemic metabolism and insulin sensitivity compared to heterozygous and wild-type littermates despite alterations in lipid biosynthesis pathways .

  • Reduced hepatocellular damage: Activation of SREBPs resulting from INSIG1 deficiency leads to decreased hepatocellular damage and improved wound-healing responses in the context of NASH .

These findings suggest that the SCAP/SREBP/INSIG1 regulatory trio governs transcriptional programs that may actually protect the liver from lipotoxic insults in NASH, rather than exacerbating disease progression. This represents a paradigm shift in understanding INSIG1's role in fatty liver disease, suggesting that activating certain lipid synthesis pathways might yield protective adaptations rather than harmful consequences .

What methodological approaches can be used to study INSIG1-mediated protein degradation?

INSIG1 has been implicated in protein degradation pathways beyond its classical role in cholesterol metabolism. Studies investigating INSIG1's role in HIV-1 Gag protein degradation provide valuable methodological approaches applicable to other INSIG1-related degradation processes:

Protein stability assessment:

  • Cycloheximide chase assays to monitor protein half-life in the presence and absence of INSIG1.

  • Pulse-chase experiments with radiolabeled amino acids to track protein synthesis and degradation rates.

Degradation pathway identification:

  • Selective inhibitors of proteasomal (MG132) versus lysosomal (bafilomycin A1, chloroquine) degradation to distinguish between these pathways.

  • Co-immunoprecipitation experiments to identify interactions between INSIG1, target proteins, and components of degradation machinery.

E3 ligase involvement:

  • INSIG1 has been shown to coordinate with specific E3 ubiquitin ligases, including TRC8 (also known as RNF139), for target protein degradation .

  • Generation of E3 ligase knockout cell lines (e.g., trc8 knockout Jurkat cells) to confirm ligase involvement in INSIG1-mediated degradation processes .

Ubiquitination detection:

  • Expression of HA-tagged ubiquitin along with INSIG1 and target proteins to monitor ubiquitination status.

  • Immunoprecipitation followed by western blotting with anti-ubiquitin antibodies to detect ubiquitinated target proteins.

The coordination between INSIG1 and TRC8 in promoting degradation through the lysosome pathway represents a distinct mechanism from the previously established INSIG1-AMFR (gp78) interaction that promotes HMGCR degradation through the proteasome . This methodological diversity highlights the importance of comprehensive pathway analysis when studying INSIG1-mediated protein degradation.

What are the considerations for designing experiments to investigate INSIG1's role in viral infections?

Recent discoveries of INSIG1's involvement in viral infections, particularly HIV-1, have opened new research directions. Key experimental design considerations include:

Distinguishing viral production from infection:

  • Use pseudovirus systems that separate infection from virion production into independent assays .

  • Monitor INSIG1 expression changes during different stages of viral infection and replication.

Protein-protein interaction studies:

  • Identify viral components that interact with INSIG1 through co-immunoprecipitation and mass spectrometry.

  • Map interaction domains using truncation and point mutation analyses of both INSIG1 and viral proteins.

Subcellular localization:

  • Track the intracellular location of INSIG1 and viral components using fluorescence microscopy.

  • Focus on membrane sites including endoplasmic reticulum and endosomes where both INSIG1 and viral assembly may occur .

Viral replication assessment:

  • In single-round infection systems versus multiple-round replication models.

  • Quantification of viral production through p24 ELISA, quantitative PCR, or reporter gene expression.

Response specificity:

  • INSIG1 up-regulation appears to be virion production-dependent rather than infection-dependent .

  • Expression level responds to enveloped virion generation following co-expression of Gag-pol and Env, but not to Gag-pol alone .

When designing experiments to investigate INSIG1's antiviral properties, researchers should consider that INSIG1 may function as a sentinel that responds to virion production by degrading viral structural proteins through pathways distinct from its role in cholesterol metabolism.

How does bovine INSIG1 compare to INSIG1 in other species?

INSIG1 is highly conserved across species, suggesting its fundamental importance in metabolic regulation. The table below compares key aspects of INSIG1 across different species:

When working with recombinant bovine INSIG1, researchers should consider:

  • The high degree of conservation in functional domains suggests experimental findings may translate across species

  • Species-specific metabolic adaptations may influence INSIG1 regulation and function

  • Antibodies and reagents may have variable cross-reactivity across species despite sequence homology

What methodological challenges exist when studying bovine INSIG1 compared to human or murine models?

Working with bovine INSIG1 presents several distinct methodological challenges:

Cellular models:

  • Availability of bovine-specific cell lines is limited compared to human or murine options

  • Primary bovine adipocytes or hepatocytes may better reflect species-specific regulation but present isolation and maintenance challenges

Genetic manipulation:

  • CRISPR/Cas9 efficiency may vary with bovine cell types, requiring optimization of transfection conditions and guide RNA design

  • Lower transfection efficiency in primary bovine cells compared to established human/murine lines

Reagent availability:

  • Fewer commercially available antibodies with validated specificity for bovine INSIG1

  • Limited availability of bovine-specific gene expression arrays or proteomics databases

Physiological context:

  • Ruminant metabolism differs significantly from single-stomached animals, particularly in lipid metabolism pathways

  • Dairy cattle experience unique metabolic challenges during lactation that may influence INSIG1 function

Experimental approaches to address these challenges:

  • Validate antibody cross-reactivity before conducting bovine INSIG1 studies

  • Develop species-specific primers for qPCR and optimization of western blotting conditions

  • Consider immortalized bovine cell lines where available, or heterologous expression systems with bovine INSIG1 constructs

  • Account for species-specific metabolic pathways when interpreting results related to lipid metabolism

What emerging applications of INSIG1 research show potential for therapeutic development?

Recent discoveries regarding INSIG1 function suggest several promising research directions with therapeutic potential:

NAFLD/NASH interventions:
Research has revealed that the SCAP/SREBP/INSIG1 regulatory system governs transcriptional programs that protect the liver from lipotoxic insults in NASH. This suggests targeted modulation of this pathway could yield novel therapeutic strategies for NAFLD . Specific approaches might include:

  • Development of small molecules that modify INSIG1-SCAP interactions to fine-tune lipogenic responses

  • Targeting downstream effectors of the INSIG1-regulated lipid remodeling pathways

Metabolic disease management:
Understanding how INSIG1 downregulation serves as an adaptive response to preserve lipogenic capacity during insulin resistance could inform metabolic disease interventions . Potential applications include:

  • Therapeutic approaches that enhance the adaptive capacity of adipose tissue through INSIG1 modulation

  • Prevention of metabolic complications by supporting proper lipid storage in appropriate tissues

Antiviral strategies:
The discovery that INSIG1 inhibits HIV-1 production by accelerating Gag protein degradation through the lysosomal pathway opens intriguing antiviral research directions . Future work might explore:

  • Small molecule enhancers of INSIG1-TRC8 activity as potential antiviral agents

  • Broader applicability of INSIG1-mediated protein degradation against other viruses

  • Development of peptide mimetics that enhance INSIG1's interaction with viral proteins

How can advanced technologies enhance INSIG1 research methodologies?

Emerging technologies offer significant potential to advance INSIG1 research:

Single-cell technologies:

  • Single-cell RNA sequencing to identify cell-specific INSIG1 expression patterns in heterogeneous tissues like liver and adipose tissue

  • Single-cell proteomics to detect cell-to-cell variation in INSIG1 protein levels and modifications

Advanced imaging techniques:

  • Super-resolution microscopy to visualize INSIG1 localization and dynamics at the ER membrane

  • Live-cell imaging with tagged INSIG1 to track protein movement and interactions in real-time

Proteomics approaches:

  • Proximity labeling techniques (BioID, APEX) to identify novel INSIG1 interaction partners

  • Affinity purification-mass spectrometry to map the complete INSIG1 interactome under various metabolic conditions

Computational modeling:

  • Systems biology approaches to integrate INSIG1 into broader metabolic regulatory networks

  • Structural modeling of INSIG1 interactions with partners to facilitate drug design

Genome editing advancements:

  • Inducible and tissue-specific CRISPR systems for temporal and spatial control of INSIG1 expression

  • Base editing or prime editing for introducing specific INSIG1 mutations without double-strand breaks

These technological approaches will enable researchers to address more nuanced questions about INSIG1 function and regulation, potentially uncovering novel therapeutic targets and applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.