Recombinant Bovine Integral membrane protein 2C (ITM2C)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
ITM2C; Integral membrane protein 2C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
ITM2C
Target Protein Sequence
MVKISFQPAVAGIKGDKADKASASASASAPAPTPAAEILLTPAREERPPYQRYKKGGSVG GVCYLSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFHCGVLYEDSLSSQAHTRMELEE DVKIYLEENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPP RNFWELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCSGKDTYRLRRRATR RRINKREAKNCNAIRHFENTFVVETLICGVV
Uniprot No.

Target Background

Function
Recombinant Bovine Integral membrane protein 2C (ITM2C) acts as a negative regulator of amyloid-beta peptide production. It may inhibit APP processing by preventing access to alpha- and beta-secretase. ITM2C exhibits negligible binding to the beta-secretase-cleaved APP C-terminal fragment, indicating weak gamma-secretase inhibition. ITM2C may also play a role in TNF-induced cell death and neuronal differentiation.
Database Links
Protein Families
ITM2 family
Subcellular Location
Lysosome membrane; Single-pass type II membrane protein. Cell membrane; Single-pass type II membrane protein.

Q&A

What expression systems are most effective for producing recombinant bovine ITM2C?

E. coli has been demonstrated as an effective expression system for producing recombinant bovine ITM2C. For optimal results:

  • Use a construct with an N-terminal His-tag for purification purposes

  • Express the full-length protein (1-271 amino acids)

  • Optimize codon usage for E. coli if expression levels are low

  • Consider including IPTG-inducible promoters for controlled expression

After expression, purification typically involves affinity chromatography using the His-tag, followed by additional purification steps if higher purity is required .

How should recombinant bovine ITM2C be handled and stored for maximum stability?

For optimal handling and storage:

  • Store lyophilized protein at -20°C to -80°C

  • After reconstitution, aliquot the protein to avoid repeated freeze-thaw cycles

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C

  • Working aliquots may be stored at 4°C for up to one week

  • Use Tris/PBS-based buffer with 6% Trehalose at pH 8.0 for storage

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

What are the known cellular localizations of ITM2C and how does this influence experimental design?

ITM2C is primarily localized in:

  • Golgi apparatus

  • Lysosomal membranes

  • Plasma membrane

  • Perinuclear region of cytoplasm

This multi-compartment distribution necessitates careful experimental design for localization studies. When investigating ITM2C function:

  • Use compartment-specific markers (e.g., GM130 for Golgi, LAMP1 for lysosomes)

  • Consider subcellular fractionation to isolate specific organelles

  • For immunofluorescence, perform permeabilization optimization to access intracellular ITM2C

  • Be aware that overexpression may alter natural localization patterns

What methodologies are recommended for investigating ITM2C's role in autophagy regulation?

Based on research with the related protein ITM2A, studying ITM2C's role in autophagy should incorporate:

  • Autophagic flux assessment:

    • Monitor LC3-II and p62 levels by western blotting

    • Utilize tandem fluorescent-tagged LC3 (mRFP-GFP-LC3) to distinguish autophagosomes from autolysosomes

    • Examine autophagic vacuoles via transmission electron microscopy

  • mTOR pathway analysis:

    • Evaluate phosphorylation status of mTOR targets (e.g., p-4EBP1 at T37/46)

    • Assess AMPK activity to determine pathway specificity

    • Use mTOR inhibitors (rapamycin, Torin1) as positive controls

  • Genetic manipulation approaches:

    • Generate stable ITM2C overexpression and knockdown cell models

    • Create phosphorylation-deficient mutants to examine regulation

    • Use CRISPR/Cas9 for complete knockout studies

  • Functional readouts:

    • Cell proliferation assays (MTT, EdU incorporation)

    • Colony formation assays

    • Starvation response experiments using EBSS media

How can researchers effectively study post-translational modifications of ITM2C?

To investigate PTMs of ITM2C, particularly phosphorylation:

  • Identification strategies:

    • Immunoprecipitate ITM2C and analyze by mass spectrometry

    • Use phospho-specific antibodies in western blotting

    • Employ Phos-tag SDS-PAGE for mobility shift detection

  • Functional validation:

    • Generate site-specific mutants (e.g., T→A for phosphorylation sites)

    • Perform in vitro kinase assays with candidate kinases

    • Use phosphomimetic mutations (T→D/E) to study constitutive activation

  • Biological significance assessment:

    • Compare wild-type and mutant ITM2C in functional assays

    • Identify binding partners that interact in a phosphorylation-dependent manner

    • Examine effects on subcellular localization

  • Relevant controls:

    • Include phosphatase treatment conditions

    • Use kinase inhibitors to validate specificity

    • Analyze effects of cellular stress (e.g., starvation) on modification status

What approaches are recommended for identifying and validating ITM2C binding partners?

For comprehensive identification and validation of ITM2C binding partners:

  • Discovery methods:

    • Tandem affinity purification (TAP) with mass spectrometry

    • Proximity-dependent biotin identification (BioID)

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

  • Validation techniques:

    • Reciprocal co-immunoprecipitation

    • GST pull-down assays with recombinant proteins

    • Förster resonance energy transfer (FRET)

    • Proximity ligation assay (PLA) for detecting interactions in situ

  • Domain mapping:

    • Generate truncation mutants to identify interaction regions

    • Use peptide arrays to identify specific binding motifs

    • Perform alanine scanning mutagenesis of key residues

  • Functional significance:

    • Determine if interactions are modulated by cellular state

    • Assess consequences of disrupting specific interactions

    • Examine co-localization under various cellular conditions

What are the challenges and solutions in studying ITM2C's role in amyloid-beta regulation?

Challenges and methodological solutions:

  • Challenges:

    • Distinguishing direct vs. indirect effects on APP processing

    • Maintaining physiological expression levels

    • Addressing potential redundancy with ITM2A and ITM2B

    • Translating in vitro findings to in vivo relevance

  • Experimental approaches:

    • APP processing analysis:

      • Measure secreted Aβ by ELISA after ITM2C manipulation

      • Assess APP cleavage products (C-terminal fragments) by western blot

      • Use cell-free γ-secretase activity assays with purified components

    • Interaction studies:

      • Examine direct binding between ITM2C and APP using purified proteins

      • Map domains involved in APP interaction

      • Investigate competition with secretase enzymes for APP binding

    • Model systems:

      • Generate transgenic models with ITM2C overexpression/knockout

      • Use induced pluripotent stem cells differentiated to neurons

      • Implement organoid models for 3D culture environments

How can researchers design effective comparative studies between bovine and human ITM2C?

For rigorous cross-species ITM2C comparisons:

  • Sequence and structural analysis:

    • Perform comprehensive sequence alignment to identify conserved domains and species-specific regions

    • Generate homology models based on available crystal structures

    • Analyze conservation of potential post-translational modification sites

  • Functional conservation assessment:

    • Create chimeric proteins with domain swapping between species

    • Express each species' protein in the same cellular background

    • Perform rescue experiments in knockout models

  • Experimental design considerations:

    • Use equivalent tags and expression systems for fair comparison

    • Maintain equivalent expression levels across experiments

    • Perform parallel assays under identical conditions

    • Include species-specific positive controls for functional assays

  • Data analysis:

    • Normalize data to account for expression level differences

    • Use statistical methods appropriate for cross-species comparisons

    • Consider evolutionary context when interpreting differences

What methodologies are recommended for investigating ITM2C's role in lysosomal function?

Based on information about related proteins like LIMP-2:

  • Lysosomal localization and trafficking:

    • Use fluorescent-tagged ITM2C to track movement to lysosomes

    • Perform sucrose gradient fractionation to isolate lysosomal compartments

    • Examine co-localization with established lysosomal markers

  • Functional assays:

    • Measure lysosomal pH using ratiometric probes

    • Assess lysosomal enzyme activities after ITM2C manipulation

    • Monitor lysosomal membrane permeability and integrity

  • Lipid transport studies:

    • Examine potential cholesterol binding capabilities (similar to LIMP-2)

    • Use fluorescent lipid analogs to track movement in live cells

    • Perform liposome binding assays with purified ITM2C

  • Advanced imaging techniques:

    • Implement super-resolution microscopy to visualize lysosomal membrane localization

    • Use electron microscopy to assess lysosomal morphology

    • Apply live-cell imaging to monitor dynamic changes in lysosomal function

What experimental approaches should be used to study ITM2C in the context of neurodegenerative diseases?

Given ITM2C's potential role in amyloid regulation and neuronal differentiation:

  • Cellular models:

    • Primary neuronal cultures with ITM2C manipulation

    • Differentiated iPSCs from patients with neurodegenerative diseases

    • Neuronal cell lines with disease-related mutations

  • Molecular approaches:

    • Examine effects on tau phosphorylation and aggregation

    • Assess impact on neuroinflammatory markers

    • Investigate oxidative stress response in neuronal models

  • Functional readouts:

    • Neurite outgrowth and synapse formation assays

    • Calcium imaging to assess neuronal activity

    • Measurement of neuronal survival under stress conditions

  • Translational relevance:

    • Compare ITM2C expression in post-mortem brain tissues

    • Correlate genetic variations with disease progression

    • Assess potential as a biomarker in cerebrospinal fluid

How should researchers approach designing ITM2C knockout models to study its function?

For effective ITM2C knockout model development:

  • Model system selection:

    • Consider cell type relevance to ITM2C function

    • Evaluate complete vs. conditional knockout approaches

    • Assess potential for compensatory mechanisms by related proteins (ITM2A, ITM2B)

  • Genetic manipulation strategies:

    • CRISPR/Cas9 system for precise gene targeting

    • Design multiple guide RNAs targeting different exons

    • Include strategies to avoid off-target effects

    • Consider inducible knockout systems for temporal control

  • Validation requirements:

    • Confirm genomic modifications by sequencing

    • Verify absence of protein expression by western blot

    • Assess potential truncated protein products

    • Check expression of related family members for compensation

  • Phenotypic characterization:

    • Employ comprehensive "omics" approaches (transcriptomics, proteomics)

    • Perform detailed morphological and ultrastructural analysis

    • Design functional assays based on predicted ITM2C roles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.