Recombinant Bovine Interferon alpha-inducible protein 27-like protein 2 (IFI27L2)

Shipped with Ice Packs
In Stock

Description

Human IFI27L2 Research Insights

Application AreaKey Findings (Human Studies)Source
NeuroinflammationIFI27L2 upregulation in microglia promotes mitochondrial ROS and pro-inflammatory cytokines (e.g., IL1β, TNFα) .
Viral PathologyIFI27L2 inhibits MDA5/RIG-I signaling, enhancing viral replication (e.g., SARS-CoV-2, IAV) .
Immune RegulationIFI27L2 expression correlates with plasma viremia and immune exhaustion in HIV infections .

Bovine-Specific Research Needs

No direct studies on bovine IFI27L2 were identified in the provided sources. Potential applications include:

  1. Bovine Viral Pathogenesis: Investigating IFI27L2’s role in modulating antiviral responses to bovine viruses (e.g., BVDV, BHV-1).

  2. Neurological Disorders: Exploring IFI27L2’s involvement in bovine neuroinflammatory diseases (e.g., BSE, rabies).

Comparative Analysis: Bovine vs. Human IFI27L2

FeatureBovine IFI27L2 (Recombinant)Human IFI27L2 (Native)
Gene Length109aa (25–133aa) 122aa (Full-length)
TagN-terminal His tag Native (no tag)
Expression SystemE. coli Endogenous (mammalian cells)
FunctionHypothetical (inferred)Pro-inflammatory, antiviral

Critical Considerations

  • Species-Specificity: Functional divergence between bovine and human IFI27L2 remains uncharacterized.

  • Research Tools: The recombinant protein is primarily used as an antigen for antibody development or biochemical assays .

  • Ethical/Regulatory: Use in bovine models requires adherence to veterinary research guidelines.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format we have in stock, we will fulfill your specific format requirements if communicated at the time of order placement.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms can be stored for 12 months under the same conditions.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have specific tag type requirements, please inform us, and we will prioritize development accordingly.
Synonyms
IFI27L2; FAM14A; Interferon alpha-inducible protein 27-like protein 2; Interferon-stimulated gene 12b protein; ISG12(b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-133
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
IFI27L2
Target Protein Sequence
AVGFTGAGIAASSLAAKMMSAAAVANGGGVAAGSLVATLQSVGAAGLSTSSNILLGSIGS AFGALLGGAKRASPSPPPGGPRPEGEQPGENVPQVEPPKSPLGPEKHEK
Uniprot No.

Target Background

Function
Plays a role in the apoptotic process and exhibits pro-apoptotic activity.
Database Links
Protein Families
IFI6/IFI27 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Bovine IFI27L2 and how does it function in immune responses?

Bovine IFI27L2 belongs to the interferon-inducible protein 27 family, which functions in regulating innate immune responses. Based on studies of human IFI27 and mouse Ifi27l2a orthologs, it likely plays a role in modulating antiviral immune responses by interacting with pattern recognition receptors (PRRs). The human ortholog has been shown to interact with viral RNA and RIG-I (retinoic acid-inducible gene I), impairing RIG-I activation and providing a negative feedback mechanism that prevents excessive inflammatory responses to RNA viral infections . Similarly, human IFI27 inhibits MDA5 (melanoma differentiation-associated protein 5) oligomerization and activation, countering innate immune responses during viral infections such as SARS-CoV-2 .

In experimental models using the murine ortholog Ifi27l2a, the protein has demonstrated pro-inflammatory properties, particularly in the context of neuroinflammation. Induction of Ifi27l2a in microglia can stimulate mitochondrial reactive oxygen species (ROS) production and promote inflammatory phenotypes . Comparative analysis suggests that bovine IFI27L2 may share similar functional characteristics in regulating inflammatory responses in cattle.

How is expression of bovine IFI27L2 regulated in different tissues?

Bovine IFI27L2 expression is primarily regulated by type I interferons, similar to its human and murine counterparts. While specific bovine tissue expression patterns must be experimentally determined, extrapolation from other species suggests that expression would be elevated in tissues responding to viral infections or inflammatory stimuli.

The protein is likely constitutively expressed at low levels in immune cells and certain epithelial tissues, with expression drastically increasing upon interferon stimulation. Experimental procedures to measure tissue-specific expression include RT-qPCR on RNA extracted from various bovine tissues, with primers specifically designed for bovine IFI27L2 sequences. Western blot analysis using antibodies that recognize bovine IFI27L2 can confirm protein expression patterns across tissues, though cross-reactivity testing is essential when using antibodies designed for human or murine orthologs.

What methods can be used to produce recombinant bovine IFI27L2?

Production of recombinant bovine IFI27L2 typically involves:

  • Gene synthesis or cloning of the bovine IFI27L2 coding sequence from bovine cDNA libraries.

  • Insertion into an appropriate expression vector (e.g., pET, pCAGGS, or pFastBac) with suitable tags (His, FLAG, or HA) for detection and purification .

  • Expression in prokaryotic systems (E. coli) for high yield, though mammalian expression systems (HEK293T, CHO cells) may provide better folding and post-translational modifications.

  • Optimization of expression conditions including IPTG concentration (for bacterial systems), temperature, and induction time.

  • Purification using affinity chromatography (based on the fusion tag), followed by size exclusion chromatography to obtain highly pure protein.

  • Verification of protein identity by mass spectrometry and functional testing through RNA binding assays or cell-based functional assays as described for human IFI27 .

A notable methodological consideration is that IFI27 family proteins may form inclusion bodies in bacterial expression systems, necessitating refolding protocols or alternative expression systems.

How does bovine IFI27L2 interact with nucleic acids and pattern recognition receptors?

Based on studies of human IFI27, bovine IFI27L2 likely interacts with RNA through specific binding residues. The human ortholog contains amino acids that are predicted to bind RNA, particularly residues 60-65, 68, 69, and 82-86 . Researchers investigating bovine IFI27L2 can employ several methodologies to characterize these interactions:

  • RNA binding assays using agarose beads conjugated to poly(I:C) (a dsRNA analog) or biotinylated RNA coupled with streptavidin-conjugated agarose beads, followed by western blot detection of bound IFI27L2 .

  • Co-immunoprecipitation experiments to detect interactions with PRRs like RIG-I and MDA5. This approach involves expressing tagged versions of bovine IFI27L2 and the receptor of interest, followed by immunoprecipitation and western blot analysis .

  • Assessment of whether the interaction is direct or RNA-mediated by using RNase treatment during co-immunoprecipitation experiments.

  • Mutation of predicted RNA-binding residues (identified through sequence alignment with human IFI27) to determine their contribution to RNA binding and PRR interaction.

These experiments should be complemented with functional readouts, such as measuring IFN expression levels via RT-qPCR or reporter gene assays following viral infection or poly(I:C) treatment, in the presence or absence of bovine IFI27L2 .

What is the role of bovine IFI27L2 in viral pathogenesis and how does it compare to orthologs in other species?

The role of bovine IFI27L2 in viral pathogenesis likely involves negative regulation of interferon responses, similar to human IFI27. To investigate this:

  • Generate bovine cell lines (e.g., bovine epithelial cells) with IFI27L2 knocked out using CRISPR-Cas9, similar to the A549 IFI27 KO model described for human cells . This requires designing guide RNAs specific to the bovine IFI27L2 sequence and confirming knockout by sequencing and western blot.

  • Alternatively, employ siRNA knockdown approaches as demonstrated with human IFI27 . Design siRNAs specific to bovine IFI27L2 and validate knockdown efficiency at both mRNA (RT-qPCR) and protein (western blot) levels.

  • Following knockout or knockdown, infect cells with bovine-relevant viruses (e.g., bovine respiratory syncytial virus, bovine viral diarrhea virus) and measure viral titers using plaque assays or immunofocus assays .

  • Analyze expression of ISGs and pro-inflammatory cytokines using RT-qPCR to assess the impact of IFI27L2 depletion on innate immune responses .

  • Perform comparative studies using human IFI27 and mouse Ifi27l2a to identify species-specific functions through rescue experiments in knockout cells.

Interspecies comparison should include sequence alignment, structural modeling, and functional complementation experiments to identify conserved and divergent features that might reflect adaptation to species-specific viral challenges.

How does bovine IFI27L2 influence mitochondrial ROS production and pro-inflammatory signaling?

Based on studies of murine Ifi27l2a, bovine IFI27L2 may affect mitochondrial function and pro-inflammatory signaling. To investigate this relationship:

  • Express bovine IFI27L2 in bovine macrophages or microglia and measure mitochondrial ROS production using fluorescent probes such as MitoSOX Red .

  • Analyze mitochondrial membrane potential changes using JC-1 or TMRE dyes in cells expressing different levels of IFI27L2.

  • Assess the impact on NLRP3 inflammasome activation by measuring caspase-1 activity and IL-1β production in the presence or absence of IFI27L2.

  • Investigate potential interactions with mitochondrial proteins through co-immunoprecipitation and proximity ligation assays.

  • Evaluate the effects of antioxidants on IFI27L2-mediated inflammatory responses to determine if ROS production is a necessary component of its pro-inflammatory function.

This approach would require careful validation of antibodies and reagents for bovine systems, potentially including the development of custom antibodies against bovine IFI27L2 if commercial options lack specificity.

What are the optimal conditions for expressing and purifying recombinant bovine IFI27L2?

Based on protocols used for human IFI27, optimal expression and purification of recombinant bovine IFI27L2 would involve:

Expression system selection:

  • Bacterial expression: pET vectors in E. coli BL21(DE3) for high yield

  • Mammalian expression: pCAGGS vectors in HEK293T cells for proper folding and post-translational modifications

Expression optimization table:

ParameterBacterial SystemMammalian System
Temperature18-25°C (lower temperatures reduce inclusion body formation)37°C with 5% CO₂
Induction0.1-0.5 mM IPTGConstitutive or inducible promoters
Duration4-16 hours48-72 hours post-transfection
Media supplements2% glucose to reduce leaky expressionFBS (5-10%)
Fusion tagsHis₆, GST, or MBP (MBP may enhance solubility)His₆, FLAG, or HA tags

Purification strategy:

  • Lysis buffer optimization: Test buffers containing 20-50 mM Tris-HCl (pH 7.5-8.0), 150-500 mM NaCl, with various additives (5-10% glycerol, 0.1-1% Triton X-100)

  • Affinity chromatography: Ni-NTA for His-tagged proteins

  • Size exclusion chromatography: To remove aggregates and ensure monodispersity

  • Verification: SDS-PAGE, western blot, and mass spectrometry

Critical considerations:

  • RNA contamination: Include RNase treatment during purification if RNA binding studies are planned

  • Protein stability: Characterize thermal stability using differential scanning fluorimetry

  • Functional validation: Verify RNA binding activity using poly(I:C) pull-down assays

How can researchers effectively measure the impact of bovine IFI27L2 on innate immune signaling?

To effectively measure the impact of bovine IFI27L2 on innate immune signaling, researchers should implement multiple complementary approaches:

  • Cell-based reporter assays: Transfect bovine cells with luciferase reporters driven by IFN-responsive promoters (e.g., ISRE, IFN-β) along with bovine IFI27L2 expression constructs or knockdown tools. Measure luciferase activity following stimulation with poly(I:C) or viral infection .

  • RT-qPCR analysis: Quantify expression of key ISGs and cytokines (IFIT2, IFNL1, CXCL10) in IFI27L2-overexpressing or IFI27L2-depleted cells after innate immune stimulation . Design primers specific to bovine genes of interest.

  • Protein-protein interaction studies: Perform co-immunoprecipitation of IFI27L2 with RIG-I, MDA5, and downstream signaling molecules like MAVS to identify interaction partners . Use crosslinking approaches to capture transient interactions.

  • Pathway analysis: Examine the phosphorylation status of key signaling proteins (IRF3, TBK1, NF-κB) by western blot in the presence or absence of IFI27L2 following immune stimulation.

  • Single-cell analysis: Implement single-cell RNA sequencing to identify cell-type specific effects of IFI27L2 on immune responses, particularly in mixed primary cell populations .

  • In vivo validation: Develop transgenic cattle models or use CRISPR-engineered primary bovine cells in reconstitution experiments to validate in vitro findings.

These methodological approaches should be performed with appropriate controls, including comparison to empty vector transfections and non-targeting siRNAs, to ensure reliable interpretation of results .

How should researchers address contradictory findings in IFI27L2 function across different experimental systems?

Contradictory findings regarding IFI27L2 function may arise from several sources. Researchers should address these systematically:

  • Species-specific differences: Although orthologs share homology, bovine IFI27L2 may have evolved distinct functions from human IFI27 or mouse Ifi27l2a. Conduct comprehensive sequence and structural comparisons, followed by cross-species complementation experiments to identify functional conservation or divergence .

  • Cell type specificity: IFI27 family proteins may function differently across cell types. The effect observed in microglia may differ from effects in epithelial cells . Always specify the cellular context and validate findings across multiple relevant cell types.

  • Stimulus-dependent effects: The effect of IFI27L2 may vary depending on the triggering stimulus (viral RNA, poly(I:C), interferons). Carefully document the stimulus used and compare responses across multiple stimuli .

  • Temporal dynamics: Early vs. late effects may differ. For instance, initial negative regulation of innate immunity might be followed by different long-term effects. Conduct time-course experiments to capture the full spectrum of IFI27L2 activities .

  • Expression level considerations: Overexpression artifacts may not reflect physiological function. Complement overexpression studies with knockout/knockdown approaches and ideally, use inducible systems that allow titration of expression levels .

When reporting contradictory findings, present complete datasets including negative results, use quantitative rather than qualitative assessments, and employ statistical analyses appropriate for the experimental design. Consider publishing raw data in repositories to enable independent analysis by other researchers.

What are the key considerations for translating in vitro findings about bovine IFI27L2 to in vivo applications?

Translating in vitro findings about bovine IFI27L2 to in vivo applications requires careful consideration of several factors:

  • Physiological expression levels: In vitro studies often involve overexpression or complete knockout, which may not reflect the more nuanced expression changes in vivo. Use quantitative methods to determine physiological expression ranges in target tissues and design experiments accordingly .

  • Tissue-specific effects: The function of IFI27L2 may vary across different tissues. For in vivo applications, assess expression and function in multiple relevant tissues through tissue-specific conditional knockout models or cell type-specific reporters .

  • Temporal dynamics during infection: The kinetics of IFI27L2 expression during natural infections may be critical to its function. Monitor expression over the course of infection in appropriate animal models .

  • Genetic variation in cattle populations: Polymorphisms in bovine IFI27L2 might affect function or expression. Screen for genetic variants in target populations and assess their functional significance before broad application .

  • Age-dependent effects: As observed with mouse Ifi27l2a in the context of stroke, age may influence expression patterns and functional outcomes. Include age as a variable in experimental designs and analyses .

To address these considerations, researchers should initially validate findings in primary bovine cells before progressing to ex vivo tissue models and ultimately in vivo studies. The hemizygous deletion approach used for mouse Ifi27l2a provides a useful model for testing partial reduction versus complete knockout , which may be more translatable to therapeutic interventions.

How might bovine IFI27L2 be leveraged for developing novel antiviral or anti-inflammatory strategies in cattle?

Bovine IFI27L2 represents a potential target for novel therapeutic strategies in cattle, based on its likely role in modulating innate immune responses. Several approaches warrant investigation:

  • Targeted inhibition for enhancing antiviral responses: If bovine IFI27L2 functions similarly to human IFI27 as a negative regulator of antiviral immunity, temporary inhibition could enhance protection during acute viral challenges. Approaches may include:

    • Small molecule inhibitors targeting IFI27L2-RNA or IFI27L2-protein interactions

    • Antisense oligonucleotides or siRNAs for transient knockdown

    • CRISPR-based approaches for tissue-specific editing

  • IFI27L2 augmentation for controlling inflammatory conditions: In inflammatory conditions where excessive immune activation is detrimental, enhancing IFI27L2 activity might reduce pathology. This strategy could be particularly relevant for inflammatory respiratory or neurological conditions in cattle .

  • Biomarker development: Similar to human IFI27's potential as a COVID-19 biomarker, bovine IFI27L2 expression levels might serve as predictive indicators for disease outcomes in cattle viral infections . Establish baseline expression levels and determine threshold values predictive of disease progression.

  • Vaccine adjuvant engineering: Understanding how IFI27L2 modulates innate immunity could inform the development of novel vaccine adjuvants that precisely tune immune responses to bovine pathogens.

These approaches require careful validation, beginning with detailed characterization of bovine IFI27L2's role in relevant infectious and inflammatory conditions. The partial reduction strategy that proved beneficial in mouse stroke models might provide a useful framework for modulating rather than completely inhibiting IFI27L2 function .

What emerging technologies will advance our understanding of bovine IFI27L2 structure-function relationships?

Several emerging technologies will significantly advance our understanding of bovine IFI27L2 structure-function relationships:

  • Cryo-electron microscopy: This approach can reveal the molecular structure of IFI27L2 alone and in complex with interaction partners like RIG-I or MDA5, providing insights into binding interfaces that could be targeted for therapeutic intervention .

  • AlphaFold and other AI-based structure prediction: These computational approaches can predict bovine IFI27L2 structure with high accuracy, enabling rational design of mutants for functional studies and potential inhibitor development.

  • Single-molecule techniques: Methods such as fluorescence resonance energy transfer (FRET) and atomic force microscopy can elucidate the dynamics of IFI27L2 interactions with RNA and proteins in real-time, providing mechanistic insights beyond static structural information .

  • CRISPR base editing and prime editing: These refined genome editing approaches allow precise modification of specific amino acids in the endogenous bovine IFI27L2 gene, enabling detailed structure-function studies in physiologically relevant contexts.

  • Spatial transcriptomics and proteomics: These techniques can map IFI27L2 expression and interaction networks within intact tissues, revealing microenvironmental factors that influence its function .

  • Organoid models: Bovine organoids representing different tissues can provide physiologically relevant systems for studying IFI27L2 function in complex 3D cellular environments that better mimic in vivo conditions.

Integration of these technologies will provide comprehensive insights into how bovine IFI27L2 structure dictates its function in different contexts, ultimately informing rational design of therapeutic strategies targeting this protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.