Recombinant Bovine Interferon alpha-inducible protein 6 (IFI6)

Shipped with Ice Packs
In Stock

Description

Introduction to Bovine IFI6

Interferon alpha-inducible protein 6 (IFI6), also known as interferon-induced protein 6-16 or Ifi-6-16, belongs to the FAM14 family of proteins that are strongly induced by type I interferons . In bovine species, IFI6 is encoded by a gene located on chromosome 2 (Chr.2: 125662111 - 125665797 on Build ARS-UCD1) . This gene (IFI6) is identified with UniProt code Q6IED8 and NCBI Gene ID 512913, with official synonym 6-16 .

IFI6 is a small hydrophobic protein of approximately 13 kDa that plays crucial roles in immunomodulation and possesses antiapoptotic functions . The protein's expression is highly regulated by type I interferons, particularly IFN-alpha, making it a significant component of host defense mechanisms during viral infections. The bovine variant shares structural and functional similarities with human and other mammalian IFI6 proteins, highlighting its evolutionary conservation across species.

Genetic Information and Expression

The bovine IFI6 gene contains multiple exons, with characterized exon boundaries spanning positions 2-3 . According to available genomic data, the interrogated sequence corresponds to RefSeq NM_001075588.1 and GenBank mRNA BC111668.1, with assay locations at positions 145 and 168, respectively, and an amplicon length of 80 base pairs .

Expression of bovine IFI6 is primarily regulated through the JAK/STAT signaling pathway following stimulation by type I interferons . This pathway leads to the activation of transcription factors that bind to interferon-stimulated response elements (ISREs) in the promoter region of the IFI6 gene, driving its expression during immune responses.

Expression Systems

Recombinant bovine IFI6 can be produced using bacterial expression systems, particularly Escherichia coli BL21 strains. The protein is typically expressed with fusion tags such as GST (glutathione S-transferase) to facilitate purification and potentially enhance solubility . Expression conditions generally involve induction with isopropyl-β-D-thiogalactopyranoside (IPTG) at concentrations around 0.7 mM, with optimal expression occurring at lower temperatures (approximately 16°C) over extended periods (12 hours) .

The choice of expression system and conditions may vary depending on the intended application of the recombinant protein, with parameters optimized to maximize yield while maintaining proper folding and biological activity.

Purification Methods

The purification of recombinant bovine IFI6 typically follows standard protein purification protocols, adapted for the specific expression system and fusion tags employed. For GST-tagged recombinant IFI6, the general purification process involves:

  1. Cell lysis using buffers containing components such as 50 mM Tris-HCl (pH 7.6), 1 mM EDTA, 150 mM NaCl, 0.1 mg/ml lysozyme, 1 mM DTT (dithiothreitol), and 0.05% NP-40

  2. Affinity chromatography using glutathione-conjugated resins (GST-Fast Flow)

  3. Elution of the purified protein

  4. Quantification of the recombinant protein

After purification, the recombinant protein is typically stored in glycine at -80°C to maintain stability and biological activity .

Cellular Functions and Apoptosis Regulation

IFI6 functions as a pro-survival protein with significant antiapoptotic properties. Unlike its family member IFI27 which destabilizes mitochondrial function and promotes apoptosis, IFI6 stabilizes mitochondrial function, thereby inhibiting apoptotic processes . This antiapoptotic activity operates through blocking the mitochondrial release of cytochrome c, effectively discontinuing the intrinsic apoptotic pathway .

The protein's role in cellular survival is mediated through the activation of the JAK/STAT signaling pathway . Studies have demonstrated that IFI6 can antagonize TRAIL (tumor necrosis factor-related apoptosis-inducing ligand)-induced apoptosis through inhibition of the intrinsic apoptotic pathway .

Immune Response Modulation

Recent research has revealed that IFI6 serves as a negative regulator of innate immune responses . Studies have demonstrated that knocking down or knocking out IFI6 expression increases the expression of interferons, interferon-stimulated genes, and pro-inflammatory cytokines following viral infections .

This regulatory function appears to involve a novel interaction between IFI6 and retinoic acid-inducible gene I (RIG-I), a key sensor of viral infections that mediates the transcriptional induction of interferons and inflammatory proteins . This interaction, likely mediated through binding to RNA, affects RIG-I activation and subsequently modulates the innate immune response .

Antiviral Activity

IFI6 demonstrates significant antiviral activity against various viruses. Detailed studies with Hepatitis B Virus (HBV) have shown that overexpression of IFI6 inhibits viral replication and gene expression, while knockdown of IFI6 elevates HBV replication . The antiviral mechanism in this case involves binding to specific regions of the viral enhancer/core promoter (EnhII/Cp) elements, thereby restricting viral promoter activity .

In vivo analysis based on hydrodynamic injection of IFI6 expression plasmid along with HBV revealed significant inhibition of HBV DNA replication and gene expression . This suggests that recombinant bovine IFI6 could potentially exhibit similar antiviral properties against bovine viral pathogens, though specific studies in bovine systems would be necessary to confirm this hypothesis.

Research Applications

Recombinant bovine IFI6 serves as a valuable tool for studying immune responses in cattle. It enables researchers to investigate:

  1. Mechanisms of bovine antiviral immunity

  2. Regulation of apoptosis in bovine cells and tissues

  3. Interferon signaling pathways specific to bovine systems

  4. Host-pathogen interactions in bovine viral infections

The availability of purified recombinant bovine IFI6 facilitates both in vitro and in vivo experimental approaches, allowing for controlled studies of protein function and activity.

Research in pigs has identified associations between IFI6 gene polymorphisms, promoter methylation, and meat quality traits . A polymorphism in the IFI6 gene (g.370A>G) was significantly associated with meat pH at 24 hours post-mortem . Furthermore, DNA methylation at specific CpG sites in the IFI6 promoter was higher in samples with low meat pH compared to those with high meat pH .

These findings suggest that IFI6 might play a role in determining meat quality traits in livestock, potentially including cattle. The mRNA expression of IFI6 was significantly downregulated in samples with low meat pH compared to those with high meat pH, suggesting that higher DNA methylation at CpG sites in the promoter region might downregulate gene expression, thereby affecting muscle pH and subsequently impacting traits like drip loss and tenderness .

Recent Research Advances

Recent studies have expanded our understanding of IFI6 function across species. A significant discovery is the identification of IFI6 as a negative regulator of innate immune responses through its interaction with RIG-I . This interaction affects RIG-I activation and subsequently modulates the expression of interferons, interferon-stimulated genes, and pro-inflammatory cytokines .

Research has demonstrated that knocking out or knocking down IFI6 expression diminishes the production of infectious viral particles, including Influenza A Virus and SARS-CoV-2, likely due to enhanced antiviral responses in the absence of IFI6's negative regulatory effect on innate immunity . This suggests a complex role for IFI6 in viral infections, potentially serving as both a direct antiviral factor and a regulator of broader immune responses.

Therapeutic Potential

The dual role of IFI6 in both antiviral activity and regulation of immune responses suggests potential therapeutic applications. Research has indicated that IFI6 could be targeted to treat diseases associated with exacerbated induction of innate immune responses and to combat viral infections .

Future Research Directions

Several promising directions for future research on recombinant bovine IFI6 include:

  1. Characterization of its role in economically important bovine viral infections

  2. Investigation of associations between IFI6 genetic variants and disease resistance or production traits in cattle

  3. Exploration of its potential as a therapeutic target for managing bovine infectious diseases

  4. Development of improved recombinant expression systems for producing bovine IFI6 with enhanced stability and activity

  5. Examination of the relationship between IFI6 expression and meat quality traits in cattle, following the findings in pigs

Additionally, the recently discovered interaction between IFI6 and RIG-I in the regulation of innate immunity warrants further investigation in bovine systems . Understanding this regulatory mechanism could provide insights into how bovine immune responses are finely tuned during viral infections and other immune challenges.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during the production process. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
IFI6; Interferon alpha-inducible protein 6; Interferon-induced protein 6-16; Ifi-6-16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-134
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
IFI6
Target Protein Sequence
CCEEEDEKRYSEENSDSSFWGMVTYMAVGGGLMAAALPMLGFASTGIAANSLASSLMSWS AVANGGGVPAGGLVATLQSLGASGGSALMAKIGAFLGYTVHKQVESRQKESKEKK
Uniprot No.

Target Background

Function
Recombinant Bovine Interferon alpha-inducible protein 6 (IFI6) plays a role in apoptosis, negatively regulating the intrinsic apoptotic signaling pathway and TNFSF10-induced apoptosis. However, it has also been demonstrated to exhibit pro-apoptotic activity. IFI6 may possess antiviral activity.
Database Links

KEGG: bta:512913

STRING: 9913.ENSBTAP00000009939

UniGene: Bt.8436

Protein Families
IFI6/IFI27 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Interferon Alpha-Inducible Protein 6 (IFI6) and how is it regulated in bovine systems?

IFI6 is a type I interferon-stimulated gene (ISG) that plays critical roles in cellular antiviral responses. In mammalian systems, IFI6 is primarily regulated through the JAK-STAT signaling pathway following interferon stimulation. The protein is negatively regulated by transcription factors such as ATF3 (Activating Transcription Factor 3), which binds to the promoter regions of IFI6 . While specific bovine regulatory mechanisms may have unique features, the fundamental interferon-mediated induction pathway is likely conserved across mammals based on comparative genomic analyses.

In experimental systems, IFI6 expression can be robustly induced by treating cells with type I interferons (particularly IFN-α). Researchers typically observe significant upregulation within 4-24 hours of interferon treatment, making this a reliable method for studying IFI6 induction dynamics .

How does bovine IFI6 structure compare to human and other mammalian counterparts?

Bovine IFI6 shares significant structural homology with human IFI6, though complete crystallographic data remains limited. The protein is characterized as an ER-localized integral membrane effector that is stabilized through interactions with BiP (Binding immunoglobulin Protein) . While most structural studies have focused on human IFI6, bovine IFI6 likely maintains the key features:

  • A signal peptide at the N-terminus (approximately 32 amino acids)

  • Transmembrane domains that anchor it to the ER membrane

  • Conserved regions for protein-protein interactions

When designing experiments with recombinant bovine IFI6, researchers should consider these structural features, particularly when creating tagged versions or truncated constructs for functional studies.

What are the optimal systems for expressing recombinant bovine IFI6?

For efficient expression of recombinant bovine IFI6, several expression systems have proven effective, each with distinct advantages:

Bacterial Expression Systems:

  • E. coli BL21(DE3) strains can be used with pET vectors containing codon-optimized bovine IFI6 sequences

  • Expression typically requires lower temperatures (16-25°C) to enhance proper folding

  • Consider fusion tags (e.g., 6xHis, GST, or MBP) to improve solubility and facilitate purification

Mammalian Expression Systems:

  • HEK293 or CHO cells transfected with mammalian expression vectors (e.g., pcDNA) yield properly folded and post-translationally modified IFI6

  • These systems are particularly valuable when studying protein-protein interactions or functional assays

  • Stable cell lines can be generated using lentiviral transduction followed by antibiotic selection

When designing expression constructs, researchers commonly incorporate epitope tags (3×FLAG, HA) to facilitate detection and purification, as demonstrated in previous studies . The choice between C-terminal or N-terminal tagging should consider that N-terminal signal peptides (first 32 amino acids) are critical for proper localization.

What purification strategies yield the highest quality recombinant bovine IFI6?

Purifying membrane-associated proteins like IFI6 presents specific challenges. A multi-step purification strategy typically yields the best results:

  • Membrane Fraction Isolation:

    • Differential centrifugation to separate membrane fractions

    • Solubilization using mild detergents (0.5-1% DDM, CHAPS, or Triton X-100)

  • Affinity Chromatography:

    • For His-tagged constructs: Ni-NTA affinity chromatography

    • For FLAG-tagged constructs: Anti-FLAG M2 affinity gel

  • Size Exclusion Chromatography:

    • Final polishing step to remove aggregates and obtain homogeneous protein

  • Quality Control:

    • SDS-PAGE with western blotting to confirm purity and integrity

    • Mass spectrometry to verify protein identity

Maintaining detergent concentrations above the critical micelle concentration throughout purification is essential to prevent protein aggregation. For functional studies, consider reconstituting the purified protein into liposomes or nanodiscs to maintain native-like membrane environments.

How can researchers effectively measure the antiviral activity of recombinant bovine IFI6?

Based on established protocols, several complementary approaches can be used to assess the antiviral activity of recombinant bovine IFI6:

Cell-Based Viral Inhibition Assays:

  • Transfect cells with IFI6 expression constructs or treat with purified recombinant IFI6

  • Challenge with various viral systems (examples include flaviviruses, hepadnaviruses)

  • Measure viral replication using:

    • Reporter viruses (GFP-tagged viruses like YFV-Venus or WNV-GFP)

    • qPCR for viral RNA quantification

    • ELISA for viral antigen detection (e.g., HBsAg, HBeAg)

Mechanistic Assays:

  • Promoter activity assays using luciferase reporters to assess IFI6's effect on viral promoters (e.g., HBV EnhII/Cp promoter)

  • Chromatin immunoprecipitation (ChIP) to detect direct binding of IFI6 to viral genomic elements

  • Electrophoretic mobility shift assays (EMSA) to confirm direct protein-DNA interactions

When evaluating antiviral activity, it's essential to include appropriate controls:

  • Empty vector controls

  • Knockdown/knockout controls (using CRISPR-Cas9 or siRNA)

  • Dose-dependency studies to establish clear concentration-effect relationships

What evidence exists for bovine IFI6's role in modulating cellular processes beyond antiviral defense?

While IFI6 was initially characterized for its antiviral properties, emerging evidence suggests broader cellular functions, particularly in cell growth regulation and cancer biology:

Cell Growth and Survival:

  • IFI6 overexpression has been linked to enhanced cell growth in certain cancer contexts

  • IFI6 knockdown in TSCC cells reduced cell growth and migration, suggesting a pro-growth function

Subcellular Localization and Implications:

  • Although previous studies suggested mitochondrial or ER localization, more recent evidence indicates nuclear localization in some contexts, suggesting potential roles in transcriptional regulation

  • The differential localization may be cell-type or stimulus-dependent

To investigate these non-antiviral functions, researchers can employ:

  • Cell proliferation assays (MTT, CCK8, or BrdU incorporation)

  • Migration/invasion assays (wound healing, transwell)

  • Subcellular fractionation followed by western blotting to confirm localization

  • Co-immunoprecipitation to identify novel binding partners in different cellular compartments

How can researchers effectively generate and validate IFI6 knockout models for studying bovine IFI6 function?

CRISPR-Cas9 genome editing has emerged as the preferred method for generating IFI6 knockout models. Based on published protocols, the following approach is recommended:

Design and Implementation:

  • Design at least 2-3 guide RNAs targeting early exons of bovine IFI6

  • Clone guides into lentiCRISPRv2 or similar vectors containing selection markers (puromycin or blasticidin)

  • Transduce target cells and apply appropriate antibiotic selection

  • For improved knockout efficiency, consider co-expressing two distinct guides targeting different regions of IFI6 (dual guide approach)

Validation Strategy:

  • Genomic validation: PCR amplification and sequencing of target regions

  • Protein validation: Western blotting with antibodies against IFI6

  • Functional validation: Confirm phenotypes (e.g., enhanced viral susceptibility)

  • Single-cell cloning: Isolate and expand individual clones for homogeneous knockout populations

Recommended Controls:

  • Non-targeting guide RNA controls

  • Rescue experiments with wild-type IFI6 to confirm specificity

  • Heterozygous knockout controls where possible

This approach has been successfully employed in various cell types, resulting in IFI6 knockout lines that demonstrate enhanced susceptibility to multiple viruses, confirming IFI6's antiviral function .

What are the key considerations when designing protein-protein interaction studies involving bovine IFI6?

Given IFI6's membrane association and multiple cellular localizations, protein-protein interaction studies require careful methodological considerations:

Recommended Approaches:

  • Co-immunoprecipitation:

    • Use mild detergents (0.5% NP-40 or 1% Triton X-100) to preserve interactions

    • Consider crosslinking (1-2% formaldehyde) before lysis to capture transient interactions

    • Employ both N- and C-terminally tagged constructs to minimize tag interference

  • Proximity Labeling:

    • BioID or TurboID fusion constructs to identify proximal proteins in living cells

    • Particularly valuable for membrane-associated proteins like IFI6

  • FRET/BRET Assays:

    • For studying interactions in real-time in living cells

    • Requires careful control of expression levels to avoid artifacts

Known Interaction Partners:

  • BiP (immunoglobulin binding protein) - stabilizes IFI6 in the ER

  • Potential interactions with viral proteins (e.g., HBV components)

When reporting interaction data, quantitative measures (e.g., enrichment ratios) and statistical analyses should be included to distinguish specific from non-specific interactions.

How can researchers overcome the detection challenges associated with bovine IFI6 analysis?

IFI6 detection presents several challenges, including low endogenous expression levels and antibody specificity issues. A multi-faceted approach offers the best solution:

Antibody Selection and Validation:

  • Commercial antibodies should be validated for bovine IFI6 specificity using knockout controls

  • When possible, use tagged recombinant constructs (HA, FLAG, or V5) and detect with highly specific tag antibodies

Enhanced Detection Methods:

  • For western blotting:

    • Concentrate samples through immunoprecipitation before analysis

    • Use enhanced chemiluminescence substrates or fluorescent secondary antibodies

    • Consider LI-COR Odyssey systems for improved sensitivity and quantification

  • For immunofluorescence:

    • Signal amplification via tyramide signal amplification (TSA)

    • Super-resolution microscopy for detailed localization studies

    • Co-staining with organelle markers (ER, nuclear, mitochondrial) to confirm localization

  • For low abundance detection:

    • Induce expression with IFN-α treatment (typically 100-1000 U/ml for 12-24 hours)

    • Enrich specific cellular compartments through fractionation

Each detection method should include appropriate controls, including IFI6 knockout cells and competing peptide controls for antibody specificity.

What approaches help resolve reproducibility issues in IFI6 functional studies?

Reproducibility challenges in IFI6 research often stem from variation in expression levels, cell-type differences, and technical variables. To mitigate these issues:

Standardization Recommendations:

  • Cell Systems:

    • Use early-passage cells with consistent culture conditions

    • For bovine studies, consider primary bovine cells alongside established lines

    • Document cell density at experimental endpoints (confluence affects ISG expression)

  • Expression Systems:

    • Use inducible expression systems (Tet-On/Off) to control expression levels precisely

    • Quantify expression levels via qPCR and western blot in each experiment

    • Consider stable cell lines rather than transient transfection when possible

  • Interferon Stimulation:

    • Standardize IFN preparations, concentrations, and treatment durations

    • Include time-course analyses to account for temporal variation in response

    • Consider species compatibility (bovine cells respond differently to human vs. bovine IFNs)

  • Viral Challenge Protocols:

    • Standardize viral stocks (quantified by multiple methods)

    • Control for multiplicity of infection (MOI) and infection duration

    • Include multiple time points to capture the full range of antiviral effects

Data Reporting Standards:

  • Report all experimental parameters in detail, including cell passage number

  • Include biological replicates (n≥3) from independent experiments

  • Perform appropriate statistical analyses with clearly stated methods

How might comparative studies between bovine and human IFI6 reveal evolutionarily conserved antiviral mechanisms?

Comparative analysis between bovine and human IFI6 offers valuable insights into conserved antiviral defense mechanisms. A methodological framework for such studies would include:

Sequence and Structure Analysis:

  • Multiple sequence alignment of IFI6 across species to identify conserved domains

  • Homology modeling of bovine IFI6 based on human structural data

  • Conservation analysis of key functional regions (e.g., membrane-spanning domains, interaction interfaces)

Functional Conservation Testing:

  • Cross-species complementation assays:

    • Express bovine IFI6 in human IFI6-knockout cells and vice versa

    • Challenge with various viruses to assess functional conservation

    • Measure antiviral activity against diverse viral families

  • Domain swap experiments:

    • Create chimeric proteins with domains from human and bovine IFI6

    • Identify which regions confer species-specific functions

    • Map critical residues through site-directed mutagenesis

Evolutionary Implications:

  • Analyze selection pressure (dN/dS ratios) across IFI6 sequences

  • Correlate structural conservation with host-pathogen co-evolution

  • Identify species-specific adaptations that might reflect distinct viral pressures

This approach not only advances our understanding of IFI6 biology but may also reveal broadly applicable antiviral mechanisms that could inform therapeutic development.

What novel methodologies are emerging for studying IFI6's role in virus-host interactions?

Cutting-edge approaches are expanding our understanding of IFI6's antiviral mechanisms:

Advanced Imaging Techniques:

  • Live-cell imaging with fluorescently tagged IFI6 to track dynamics during infection

  • Super-resolution microscopy (STED, PALM, STORM) to visualize nanoscale interactions

  • Correlative light and electron microscopy (CLEM) to connect molecular localization with ultrastructural context

Omics Integration:

  • Proteomics approaches:

    • Quantitative interactomics comparing IFI6 binding partners before and during infection

    • Post-translational modification analysis using mass spectrometry

    • Protein turnover studies using pulse-chase SILAC

  • Multi-omics data integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Network analysis to position IFI6 within broader antiviral pathways

    • Systems biology approaches to model dynamic responses

Emerging Genetic Technologies:

  • CRISPRi/CRISPRa for nuanced modulation of IFI6 expression

  • Inducible degradation systems (e.g., dTAG) for temporal control of IFI6 function

  • Base editing or prime editing for precise modification of endogenous IFI6

Table 1: Advanced Methodologies for IFI6 Research

MethodologyApplication to IFI6Technical ConsiderationsKey Advantages
Proximity LabelingIdentifying transient interaction partnersRequires optimization of labeling timeCaptures weak/transient interactions in native context
CRISPR ScreensIdentifying genes that modulate IFI6 functionRequires high-coverage librariesUnbiased discovery of functional partners
Single-cell RNA-seqHeterogeneity in IFI6 responseNeeds specialized analysis pipelinesReveals cell-state dependencies
Cryo-EMStructural characterizationChallenging for membrane proteinsHigh-resolution structural insights
OrganoidsTissue-level IFI6 functionRequires specialized culture systemsMore physiologically relevant than 2D culture

These emerging approaches will help resolve outstanding questions regarding IFI6's precise mechanism of action in diverse viral infections and potential non-antiviral functions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.