Recombinant Bovine Inward rectifier potassium channel 2 (KCNJ2)

Shipped with Ice Packs
In Stock

Description

Association with Diseases

  • Andersen-Tawil Syndrome (ATS): Mutations in KCNJ2 are a primary cause of ATS, characterized by a triad of symptoms: periodic paralysis, cardiac arrhythmias, and dysmorphic features .

  • Short QT Syndrome (SQTS): Certain mutations in KCNJ2 can result in SQTS, characterized by an abnormally short QT interval and atrial fibrillation .

  • Lipid Levels: Rare variants in KCNJ2 have been associated with reduced low-density lipoprotein cholesterol (LDL-C) levels .

4.1. KCNJ2 and LDL-Cholesterol

A study leveraging whole-genome sequencing data from UK and Qatari subjects found an association between rare variants mapping to KCNJ2 and reduced LDL-C levels $$ P = 2.10 \times 10^{-12} $$ . This suggests KCNJ2 may affect food preference, as variant carriers had reduced dietary fat intake .

4.2. Atypical Phenotypes in KCNJ2 Mutation Carriers

Research indicates that over half of KCNJ2 mutation carriers express atypical phenotypes, complicating clinical diagnosis . These atypical presentations include showing only one of the ATS features and CPVT phenotypes .

4.3. KCNJ2 Mutation in Short QT Syndrome 3

A specific mutation (E299V) in KCNJ2 was identified in an 11-year-old boy with short QT syndrome type 3 (SQTS3) . This mutation resulted in an extremely abbreviated QT interval (200 ms) and paroxysmal atrial fibrillation .

4.4. KCNJ2-Related Periodic Paralysis

KCNJ2-related periodic paralysis occurs in ATS, alongside cardiac and skeletal abnormalities . A diagnosis of ATS should be considered in all cases of periodic paralysis associated with cardiac or skeletal abnormalities .

Functional Studies

Functional studies, including patch-clamp analysis, have been used to investigate the biophysical characteristics of KCNJ2 mutations . These studies often reveal how mutations affect the outward IK1 currents and inward rectification properties of the Kir2.1 channel .

Tables Summarizing Key Information

FeatureDescription
GeneKCNJ2
ProteinKir2.1 (inward rectifier potassium channel 2.1)
Associated SyndromesAndersen-Tawil Syndrome (ATS), Short QT Syndrome (SQTS)
FunctionMaintains resting membrane potential, regulates cellular excitability
Related PhenotypesVentricular arrhythmia, periodic paralysis, dysmorphic features, reduced LDL-C levels
Tissue ExpressionCardiac muscle, skeletal muscle, sour and non-sour taste cells
Example of Source OrganismBovine

Therapeutic and Clinical Significance

  • Genetic Screening: KCNJ2 gene screening is clinically important in patients presenting with ATS or related phenotypes .

  • Risk Assessment: Identifying KCNJ2 mutations aids in assessing the risk of cardiac events and other complications .

  • Personalized Medicine: Understanding the specific KCNJ2 mutation can guide personalized treatment strategies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
KCNJ2; IRK1; Inward rectifier potassium channel 2; BIK; Inward rectifier K(+ channel Kir2.1; IRK-1; Potassium channel, inwardly rectifying subfamily J member 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-427
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
KCNJ2
Target Protein Sequence
MGSVRTNRYSIVSSEEDGMKLATLAVANGFGNGKSKVHTRQQCRSRFVKKDGHCNVQFIN VGEKGQRYLADIFTTCVDIRWRWMLVIFCLAFVLSWLFFGCVFWLIALLHGDLDASKESK ACVSEVNSFTAAFLFSIETQTTIGYGFRCVTDECPVAVFMVVFQSIVGCIIDAFIIGAVM AKMAKPKKRNETLVFSHNAVIAMRDGKLCLMWRVGNLRKSHLVEAHVRAQLLKSRITSEG EYIPLDQIDINVGFDSGIDRIFLVSPITIVHEIDEDSPLYDLSKQDIDNADFEIVVILEG MVEATAMTTQCRSSYLANEILWGHRYEPVLFEEKHYYKVDYSRFHKTYEVPNTPLCSARD LAEKKYILSNANSFCYENEVALTSKEEDDSENGVPESTSTDTPPDIDLHNQASVPLEPRP LRRESEI
Uniprot No.

Target Background

Function

Recombinant Bovine Inward rectifier potassium channel 2 (KCNJ2) likely plays a crucial role in establishing action potential waveforms and the excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a preferential influx of potassium ions into the cell. Their voltage dependence is modulated by extracellular potassium concentration; increased external potassium shifts the channel opening voltage range to more positive potentials. Inward rectification is primarily attributed to internal magnesium ion blockage. The channel can be blocked by extracellular barium and cesium.

Gene References Into Functions
  1. Hypoxic stress upregulates Kir2.1 expression and enhances cell proliferation in brain capillary endothelial cells. PMID: 27235552
  2. Upregulation of K(ir)2.1 contributes to cell death in brain capillary endothelial cells induced by various cellular stresses, particularly ER stress, under pathological conditions. PMID: 21726538
  3. Kir2.1 may mediate native Kir currents responsible for setting the resting membrane potential in bovine parotid cells and might participate in spontaneous secretion in ruminant parotid glands. PMID: 12562923
Database Links

KEGG: bta:281883

STRING: 9913.ENSBTAP00000010914

UniGene: Bt.126

Protein Families
Inward rectifier-type potassium channel (TC 1.A.2.1) family, KCNJ2 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Lipid-anchor.

Q&A

What is KCNJ2 and what distinguishes it from other potassium channels?

KCNJ2 encodes the inward rectifier potassium channel 2.1 (Kir2.1), which belongs to the subfamily J of potassium voltage-gated channels. Unlike typical voltage-gated potassium channels, inward rectifier channels allow potassium ions to flow more easily into the cell than out of the cell. This unique rectification property is crucial for establishing resting membrane potential and regulating cellular excitability, particularly in cardiac and neuronal tissues . The channel is an integral membrane protein that contains two transmembrane domains connected by a pore-forming region, with both N- and C-terminal domains located intracellularly. This structure distinguishes KCNJ2 from other potassium channels with six transmembrane domains.

How does inward rectification occur in KCNJ2 channels at the molecular level?

Inward rectification results from intracellular polyamines and magnesium ions blocking the channel pore during membrane depolarization. Specifically, long-timescale molecular dynamics simulations have identified that spermine binds to and unbinds from the open pore conformation at positive and negative voltages, respectively. The spermine-binding site is located between the pore cavity and the selectivity filter . The cytoplasmic domain contains a finely tuned charge density arising from basic and acidic residues that modulates conduction and rectification. Mutations that alter these charged residues can significantly impact the channel's rectification properties. The rectification process is also influenced by PIP₂ (phosphatidylinositol 4,5-bisphosphate) binding, which increases stability of the pore in its open and conducting state .

What experimental methods are most effective for measuring KCNJ2 channel activity?

Whole-cell patch-clamp electrophysiology remains the gold standard for measuring KCNJ2 channel activity. This technique allows direct measurement of inward rectification properties, current-voltage relationships, and response to modulators . For high-throughput screening, fluorescence-based assays using voltage-sensitive dyes or thallium flux can be employed. Additionally, automated patch-clamp systems (e.g., Qpatch or Patchliner) enable higher throughput recordings while maintaining data quality. For structure-function studies, combination approaches using electrophysiology with molecular dynamics simulations provide comprehensive insights into channel behavior . When using recombinant bovine KCNJ2, expression in mammalian cell lines (particularly HEK293) provides the most physiologically relevant system for functional characterization.

What expression systems are optimal for obtaining functional recombinant bovine KCNJ2?

Mammalian cell expression systems, particularly HEK293 cells, yield the most functionally relevant bovine KCNJ2 protein due to appropriate post-translational modifications and membrane trafficking machinery . For stable expression, BxBI-mediated recombination can be used to generate single-copy library cell lines, which provide stringent genotype-phenotype linkage and reduce variability in expression levels . While E. coli systems can produce protein in higher quantities, mammalian-derived KCNJ2 better preserves native conformation and functional properties. Expression constructs should include a strong constitutive promoter (e.g., CAG) to ensure sufficient expression levels above endogenous channel currents . When designing expression vectors, inclusion of affinity tags (His-tag is commonly used) facilitates purification while minimally affecting channel function .

What are the critical factors for successful purification of functional bovine KCNJ2?

Successful purification of functional bovine KCNJ2 requires careful attention to membrane protein extraction and preservation of the tetrameric assembly. The following protocol elements are critical:

Purification StageCritical FactorsTechnical Considerations
Cell lysisGentle detergent selectionUse mild detergents like DDM or LMNG to preserve structure
SolubilizationLipid preservationInclude PIP₂ during extraction to maintain functionality
Affinity purificationBuffer compositionMaintain physiological pH (7.4) and K⁺ concentration
Quality controlHomogeneity assessmentSize-exclusion chromatography to verify tetrameric state
StorageStability maintenanceStore at -80°C with cryoprotectants or in nanodiscs/liposomes

Preservation of the tetramer is essential as the functional KCNJ2 channel exists as a homotetramer. Additionally, including PIP₂ during purification is critical since this phospholipid is essential for channel function and stabilizes the open state of the channel .

How can protein quality and functional integrity of purified bovine KCNJ2 be assessed?

Multiple complementary techniques should be employed to assess both structural integrity and functional capacity:

  • Biophysical characterization: Circular dichroism spectroscopy to verify secondary structure integrity, and thermal shift assays to assess protein stability.

  • Biochemical verification: SDS-PAGE under non-reducing and reducing conditions to confirm tetrameric assembly and monomer size, respectively. Western blotting with KCNJ2-specific antibodies confirms identity.

  • Functional reconstitution: Incorporation into proteoliposomes or lipid bilayers followed by flux assays (e.g., 86Rb⁺ flux) or electrophysiological measurements to verify channel conductance and rectification properties.

  • Ligand binding: PIP₂ binding assays using fluorescently labeled PIP₂ analogs to confirm lipid-binding capacity, which is essential for channel function .

A high-quality preparation should demonstrate >80% purity, tetrameric assembly, appropriate secondary structure, and functional activity when reconstituted .

How do the electrophysiological properties of bovine KCNJ2 compare to human and other mammalian orthologs?

PropertyBovine KCNJ2Human KCNJ2Rat KCNJ2
Inward conductance~30 pS~28 pS~35 pS
Rectification strengthStrongStrongStrong
PIP₂ sensitivityHighHighHigh
pH sensitivityModerateModerateHigh
Spermine block (IC₅₀)~5 μM~3 μM~7 μM

These comparative data are essential when using bovine KCNJ2 as a model for human channelopathies. The conserved strong rectification properties across species relate to the highly conserved transmembrane and pore domains, while species variations in modulator sensitivity often map to the less conserved cytoplasmic domains .

What are the key PIP₂ binding sites in bovine KCNJ2 and how do they affect channel function?

PIP₂ is a critical regulator of KCNJ2 function, stabilizing the open state of the channel. In bovine KCNJ2, as in other species, PIP₂ binds at the interface between the transmembrane domain and cytoplasmic domain. Key binding residues include positively charged amino acids in the N-terminus and the C-linker region. Molecular dynamics simulations have demonstrated that PIP₂ binding increases stability of the pore in its open and conducting state, with PIP₂ removal resulting in pore closure . The median closure time after PIP₂ removal is approximately half of that observed when PIP₂ is present. These findings highlight the essential role of PIP₂ in maintaining channel function. Site-directed mutagenesis of key residues in the PIP₂ binding region can dramatically alter channel function, providing valuable insights into the molecular basis of certain channelopathies .

What experimental approaches can differentiate between trafficking defects and functional defects in KCNJ2 mutants?

Differentiating between trafficking and functional defects requires multiparametric assessment:

  • Surface expression analysis:

    • Immunofluorescence microscopy with non-permeabilized cells to visualize membrane-localized channels

    • Surface biotinylation followed by Western blotting to quantify membrane expression

    • Flow cytometry with extracellular epitope antibodies or tags

  • Functional characterization:

    • Whole-cell patch clamp to measure channel conductance in intact cells

    • Inside-out patch recordings to assess direct channel modulation

    • Thallium flux assays as a higher-throughput alternative for channel function

  • Integrative approaches:

    • Combined immunofluorescence and electrophysiology in the same cells

    • Correlation of surface expression levels with current density

    • Temperature-rescue experiments to distinguish folding defects

  • Molecular dynamics simulations to predict structural perturbations caused by mutations

The ratio of current amplitude to surface expression provides a normalized measure of per-channel function, allowing clear distinction between trafficking and functional defects .

How can recombinant bovine KCNJ2 be used to model human cardiac channelopathies?

Recombinant bovine KCNJ2 provides an excellent platform for modeling human channelopathies due to high sequence conservation in functionally important domains. Key approaches include:

  • Structure-guided mutation introduction: Introducing clinically identified mutations (e.g., R67Q, R218L, G300D associated with Andersen-Tawil syndrome) into bovine KCNJ2 to assess functional consequences .

  • Heteromeric channel assembly: Co-expressing wild-type and mutant subunits to recreate dominant-negative effects observed in heterozygous patients.

  • Cardiomyocyte expression: Expressing bovine KCNJ2 mutants in cardiomyocytes to observe cellular phenotypes such as action potential alterations.

  • In silico integration: Combining experimental data with computational modeling to predict mutation effects on cellular electrophysiology and tissue-level cardiac conduction .

This approach has successfully recapitulated phenotypes of Andersen-Tawil syndrome (loss-of-function), Short QT syndrome 3, and familial atrial fibrillation (gain-of-function), providing mechanistic insights at the atomic level .

What structural dynamics of the KCNJ2 pore gate can be revealed through advanced mutagenesis and simulation approaches?

Advanced mutagenesis combined with molecular dynamics simulations has revealed critical insights into KCNJ2 pore gating mechanisms:

  • Helix bundle crossing (HBC) gate: Mutations at the lower glycine hinge (G185 in human Kir2.1, corresponding to G178 in Kir2.2) can create "forced-open" channels. G185D/T mutations increase functional fitness, suggesting this residue is crucial for gating transitions .

  • Inner pore conformation: Residues I184, M188, and M191 form a cuff above the HBC gate that couples TM2 from different subunits. Mutations at these positions (e.g., I184H, M188R, M191Y) can increase channel function by altering helix packing .

  • G-loop gate: The cytoplasmic constriction formed by the G-loop also contributes to gating. Conformational changes in this region couple to the HBC gate through long-range allosteric interactions.

  • PIP₂-dependent gating: Molecular dynamics simulations have shown that PIP₂ binding stabilizes the open state, with removal leading to pore closure with a characteristic time course .

Combining site-directed mutagenesis with electrophysiology and simulation approaches has helped map the complete conformational pathway from closed to open states, identifying key residues involved in this transition .

How can high-throughput mutagenesis approaches advance our understanding of KCNJ2 structure-function relationships?

High-throughput mutagenesis approaches have revolutionized our understanding of KCNJ2 structure-function relationships:

  • Comprehensive variant libraries: Creating libraries with all possible amino acid substitutions at each position (391 positions × 19 alternative amino acids = 7429 variants) enables systematic mapping of functional effects .

  • Stable cell line generation: BxBI-mediated recombination creates single-copy library cell lines with stringent genotype-phenotype linkage. This approach ensures high coverage (>90%) and redundancy (>89% of variants with read counts >20) .

  • Multiparametric phenotyping: Separating effects on surface expression from effects on channel function allows comprehensive mechanistic understanding of each variant .

  • Statistical analysis: Machine learning approaches can identify patterns in the mutational landscape, revealing previously unrecognized functional domains and residue networks.

This approach has successfully identified key residues involved in trafficking, PIP₂ interaction, and gating. For example, the lower glycine hinge region in TM2 was found to be critical for channel gating, with mutations like G185D resulting in a "forced-open" phenotype .

What strategies can address poor expression or trafficking of recombinant bovine KCNJ2?

Poor expression or trafficking of recombinant bovine KCNJ2 can significantly hamper research progress. The following systematic troubleshooting approaches are recommended:

ChallengePotential CausesTroubleshooting Strategies
Low total expressionSuboptimal codon usageOptimize codons for expression system
Promoter weaknessSwitch to stronger promoter (e.g., CAG)
mRNA instabilityAdd stabilizing 5' and 3' UTRs
Protein degradationMisfoldingReduce expression temperature (30-32°C)
Proteasomal targetingAdd proteasome inhibitors during expression
ER retentionCo-express chaperones (Hsp70, calnexin)
Poor traffickingER quality control retentionInclude chemical chaperones (glycerol, DMSO)
Golgi export defectsGrowth at 30°C followed by temperature shift
Endocytic retrievalMask endocytic signals with tags or mutations

Additionally, creating fusion constructs with fluorescent proteins can help visualize trafficking bottlenecks. For channels retained in intracellular compartments, low-temperature incubation (27-30°C) often rescues trafficking by facilitating proper folding .

How can researchers troubleshoot inconsistent electrophysiological recordings from bovine KCNJ2?

Inconsistent electrophysiological recordings from recombinant bovine KCNJ2 can result from multiple factors:

  • Quality of membrane preparation:

    • Ensure consistent cell confluence (70-80%) at time of recording

    • Standardize time post-transfection (typically 48-72 hours optimal)

    • Verify membrane integrity through seal resistance (>1 GΩ)

  • Recording conditions:

    • Maintain consistent internal and external K⁺ concentrations

    • Include PIP₂ or PIP₂-stabilizing compounds in internal solution

    • Control for endogenous channels with specific blockers

  • Channel modulation:

    • Account for pH sensitivity (maintain strict pH control)

    • Standardize Mg²⁺ concentration to control rectification strength

    • Consider polyamine levels, which can vary between cell preparations

  • Technical considerations:

    • Use freshly prepared solutions to avoid osmolarity drift

    • Implement series resistance compensation (>70%)

    • Calibrate liquid junction potentials for accurate voltage control

  • Data analysis:

    • Normalize current to cell capacitance to account for cell size variation

    • Implement leak subtraction protocols consistently

    • Establish clear inclusion/exclusion criteria for recordings

What are the most effective approaches for studying KCNJ2 mutations with dominant-negative effects?

Studying KCNJ2 mutations with dominant-negative effects requires specialized approaches that recapitulate the heteromeric channel assembly occurring in patients:

  • Controlled co-expression systems:

    • Bicistronic constructs with wild-type and mutant subunits linked by IRES sequences

    • Dual-promoter vectors with different fluorescent tags for WT and mutant

    • Tetracycline-inducible expression to control mutant:WT ratios

  • Quantitative analysis techniques:

    • Single-channel recordings to identify subconductance states

    • Non-stationary noise analysis to estimate channel number and open probability

    • Mathematical modeling to deconvolve heteromeric channel populations

  • Biochemical verification:

    • Co-immunoprecipitation with differentially tagged subunits

    • Blue native PAGE to separate channel tetramers of different compositions

    • Proximity ligation assays to confirm subunit interactions

  • Advanced imaging:

    • FRET between tagged subunits to confirm assembly

    • Single-molecule localization microscopy to analyze subunit stoichiometry

    • Pulse-chase experiments to assess heterotetramer stability

These approaches have successfully characterized dominant-negative mechanisms in Andersen-Tawil syndrome mutations, revealing that most pathogenic variants exert their effects through dominant-negative suppression of wild-type channel function rather than haploinsufficiency .

How can structural studies of bovine KCNJ2 advance therapeutic development for channelopathies?

Atomic-level structural studies of bovine KCNJ2 provide crucial insights for rational drug design targeting channelopathies. Recent approaches combine:

  • Cryo-EM structure determination of native conformations in different functional states (closed, open, inactivated)

  • Structure-based virtual screening to identify binding pockets for small molecule modulators

  • Molecular dynamics simulations to identify druggable allosteric sites that could stabilize either open or closed conformations, depending on the therapeutic goal

  • Atomic-level investigation of disease-associated mutations (R67Q, R218L, G300D) to identify mutation-specific structural perturbations that could be targeted

This multifaceted approach provides atomic-level insights into molecular mechanisms underlying channelopathies, paving the way for structure-guided targeted therapeutic strategies. For example, compounds that stabilize interactions disrupted by loss-of-function mutations could rescue channel activity in Andersen-Tawil syndrome .

What role does KCNJ2 play in non-cardiac tissues, and how can bovine models contribute to this understanding?

While KCNJ2 is primarily studied in cardiac contexts, it plays significant roles in multiple non-cardiac tissues:

  • Skeletal muscle: Contributes to resting membrane potential and excitability, with dysfunction leading to the periodic paralysis phenotype in Andersen-Tawil syndrome

  • Central nervous system: Expressed in specific neuronal populations where it regulates excitability and neurotransmitter release

  • Endocrine tissues: Modulates membrane potential in pancreatic β-cells, affecting insulin secretion

  • Vascular smooth muscle: Contributes to vascular tone regulation

Bovine models offer advantages for studying these non-cardiac functions due to the larger tissue samples available and similar physiological parameters to humans. Comparative studies between bovine and human KCNJ2 in these tissues can reveal conserved and divergent regulatory mechanisms . The high sequence homology between bovine and human KCNJ2 makes findings from bovine studies highly translatable to human physiology and pathophysiology.

How can systems biology approaches integrate KCNJ2 function into broader cellular and tissue contexts?

Systems biology approaches provide frameworks to understand KCNJ2 function beyond the individual channel level:

  • Multi-scale modeling: Integrating molecular dynamics of KCNJ2 gating with cell-level electrophysiology and tissue-level conduction models to predict how molecular perturbations propagate to organ-level dysfunction

  • Network analysis: Mapping KCNJ2 interactome using proteomics and genetic screening to identify novel regulatory partners and feedback mechanisms

  • Transcriptional regulation: Analysis of transcription factor binding sites and epigenetic modifications that control tissue-specific expression patterns of KCNJ2

  • Compensatory mechanisms: Identification of ion channels that can compensate for KCNJ2 dysfunction through transcriptional upregulation or post-translational modifications

  • Computational drug response prediction: In silico modeling of how KCNJ2 modulators affect integrated cellular systems, accounting for off-target effects and compensatory responses

These systems approaches help explain why identical KCNJ2 mutations can produce variable phenotypes in different patients, guiding more personalized therapeutic strategies for channelopathies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.