Recombinant Bovine Keratinocyte-associated protein 2 (KRTCAP2)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Bovine Keratinocyte-associated protein 2 (KRTCAP2) is a protein that is associated with keratinocytes and involved in protein N-linked glycosylation . Glycosylation plays a vital role in biological functions such as cell recognition, immune response, and signal transduction . KRTCAP2 is situated on human chromosome 1q22 .

Basic Information

PropertyDescription
NameKeratinocyte Associated Protein 2 (KRTCAP2)
FunctionEnzyme activator activity and protein N-linked glycosylation
LocationPredicted to be located in the membrane
Chromosomal LocationHuman chromosome 1q22
Gene ID200185

Role in Gout

KRTCAP2 has been identified as a gene that increases the risk of gout . It may affect urate production and clearance by altering the expression and function of xanthine oxidoreductase (XOR) . The regulation of XOR gene expression by KRTCAP2 depends primarily on the modulation of core transcription factors such as Sp1 or PPARγ . A study identified KRTCAP2 as one of the top five genes significantly associated with gout . Increased expression of KRTCAP2 is associated with an increased risk of gout .

Interactions and Expression

KRTCAP2 expression can be influenced by various compounds :

  • Increased Expression: Several compounds and conditions can increase KRTCAP2 mRNA expression, including Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol, Tetrachlorodibenzodioxin co-treated with Cycloheximide, carbon nanotubes, chloropicrin, chlorpyrifos, and methimazole .

  • Decreased Expression: Some compounds can decrease KRTCAP2 mRNA expression, such as bisphenol F co-treated with Tretinoin, cadmium dichloride, chrysene, cisplatin, and clofibrate .

Biological Processes and Pathways

KRTCAP2 is involved in several biological processes, cellular components, and molecular functions :

  • Biological Processes: Including negative regulation of double-strand break repair via homologous recombination, negative regulation of double-strand break repair, negative regulation of DNA repair, cellular response to glucose starvation, negative regulation of DNA recombination, and protein N-linked glycosylation .

  • Cellular Components: Such as the site of DNA damage, ribonuclease MRP complex, multimeric ribonuclease P complex, peptidase inhibitor complex, serine-type endopeptidase complex, and messenger ribonuclease P complex .

  • Molecular Functions: Including ribonuclease P RNA binding, K48-linked polyubiquitin modification-dependent protein binding, ribonuclease P activity, fucosyltransferase activity, acyltransferase activity transferring groups other than amino-acyl, and mRNA regulatory element binding translation repressor activity .

KRTCAP2 is also associated with KEGG pathways such as Glycosaminoglycan Biosynthesis - Keratan Sulfate and Various Types of N-Glycan Biosynthesis .

Recombinant KRTCAP2 Availability

Recombinant Bovine KRTCAP2 is available for purchase, produced in various expression systems :

  • Yeast

  • E. coli

  • E. coli (Avi-tag Biotinylated)

  • Baculovirus

  • Mammalian cells

Genetic Variations

Unique variants in the KRTCAP2 gene are tracked and described using the NM_173852.3 transcript reference sequence .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
KRTCAP2; Keratinocyte-associated protein 2; KCP-2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit KCP2; Oligosaccharyl transferase subunit KCP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
Full length protein
Species
Bos taurus (Bovine)
Target Names
KRTCAP2
Target Protein Sequence
MVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLEN LVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATA PVLTPAKVTGKGKKRN
Uniprot No.

Target Background

Function

Recombinant Bovine Keratinocyte-associated protein 2 (KRTCAP2) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the first step in protein N-glycosylation, a co-translational process. The OST complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for optimal enzyme activity. KRTCAP2 may be involved in N-glycosylation of amyloid-beta precursor protein (APP) and can modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.

Database Links
Protein Families
KRTCAP2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is KRTCAP2 and what are its primary functions?

KRTCAP2 (Keratinocyte-associated protein 2), also known as KCP-2, is a protein-coding gene that produces a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the first step in protein N-glycosylation, involving the transfer of specific glycans from lipid carriers to asparagine residues within newly synthesized proteins . KRTCAP2 functions during protein synthesis and associates with the Sec61 complex, which facilitates protein transport across the endoplasmic reticulum .

The protein plays a significant role in:

How is recombinant KRTCAP2 typically expressed and purified for research applications?

Recombinant KRTCAP2 is commonly expressed in bacterial systems such as E. coli, though mammalian expression systems may be used when post-translational modifications are required. The typical expression and purification methodology includes:

  • Expression system selection: E. coli is frequently used for basic structural studies

  • Vector design: Including appropriate tags (His-tag is common) for purification

  • Protein expression induction: Using IPTG or similar inducers for bacterial systems

  • Cell lysis: Typically via sonication or mechanical disruption

  • Purification: Using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Quality control: Via SDS-PAGE to ensure >90% purity

  • Storage: Lyophilization with 6% trehalose in Tris/PBS buffer (pH 8.0) is recommended with storage at -20°C/-80°C

When working with recombinant bovine KRTCAP2 specifically, codon optimization for E. coli expression may be necessary to improve yield.

What experimental models are suitable for studying KRTCAP2 function?

Several experimental models have proven effective for studying KRTCAP2 function:

Model TypeApplicationsAdvantagesLimitations
Cell lines (HaCaT, HepG2)Glycosylation studies, protein-protein interactionsEasy to manipulate, human relevanceLimited complexity
Primary keratinocytesBarrier function studies, physiological relevanceNatural expression levelsShort lifespan, difficult isolation
Hepatocellular modelsCancer progression, immune interactionsDisease relevanceComplex microenvironment
Bovine primary cellsSpecies-specific studiesRelevant for veterinary applicationsLimited reagent availability
Knockout modelsLoss-of-function studiesDefinitive functional insightsPotential developmental effects

The use of siRNA or CRISPR-based knockdown/knockout approaches has been particularly informative, as demonstrated in studies where Tie2 siRNA suppressed gene expression by more than 80% at 48 hours post-transfection .

How does KRTCAP2 participate in epithelial barrier function?

While KRTCAP2's direct role in barrier function isn't fully characterized, its relationship with other barrier-associated pathways provides insights:

  • Junction protein regulation: KRTCAP2 likely influences tight junction proteins like ZO-1, VE-cadherin, and claudin-1, which are essential for maintaining epidermal barrier integrity

  • Tie2 pathway interaction: KRTCAP2 may interact with the Tie2 signaling pathway, which is crucial for barrier function. Activated Protein C (APC) enhances barrier integrity in keratinocytes via Tie2 activation, which rapidly enhances expression of junction proteins

  • Glycosylation effects: As part of the OST complex, KRTCAP2's role in N-glycosylation affects membrane proteins essential for cell-cell adhesion and barrier formation

Experimental evidence shows that inhibition of Tie2 (which may interact with KRTCAP2-dependent pathways) by its peptide inhibitor or siRNA abolishes barrier protective effects in keratinocytes . This suggests that KRTCAP2 may influence barrier function through glycosylation of key barrier proteins.

What is the role of KRTCAP2 in cancer progression and immune responses?

KRTCAP2 has emerged as a potential immunological and prognostic biomarker, particularly in hepatocellular carcinoma (HCC):

  • Expression patterns: KRTCAP2 mRNA and protein expression are markedly increased in HCC tissues compared to normal tissues

  • Prognostic significance: High KRTCAP2 expression is an independent predictive factor of unfavorable prognosis in HCC patients

  • Immune microenvironment modulation: High KRTCAP2 expression correlates with:

    • Lower proportion of CD8+ T cells in both stromal and tumor regions

    • Reduced CD68+ macrophage presence in the stroma region

    • Inverse relationship with programmed cell death ligand-1 (PD-L1) expression

  • Immunotherapy implications: Low KRTCAP2 expression groups show stronger predictive ability for positive response to immune checkpoint inhibitors

These findings suggest KRTCAP2 may influence tumor progression by modulating the immune microenvironment, potentially through its glycosylation functions affecting immune recognition and response.

How do post-translational modifications affect KRTCAP2 function?

As a component of the N-glycosylation machinery, KRTCAP2 ironically may itself be subject to post-translational modifications that regulate its function:

  • Glycosylation: KRTCAP2 may contain N-glycosylation sites that affect its stability, localization, or protein-protein interactions within the OST complex

  • Phosphorylation: Potential phosphorylation sites may regulate KRTCAP2's activity or interactions, particularly in response to cellular stress or signaling events

  • Ubiquitination: May control KRTCAP2 turnover and availability in the cell

Current research suggests that post-translational regulation of glycosylation machinery components, including KRTCAP2, may serve as cellular quality control mechanisms, particularly important during ER stress responses.

What are effective protocols for studying KRTCAP2's role in glycosylation?

To effectively study KRTCAP2's role in glycosylation, researchers should consider these methodological approaches:

  • Glycoprotein analysis:

    • Lectin blotting to detect changes in glycosylation patterns

    • Mass spectrometry to identify specific glycan structures

    • PNGase F treatment to remove N-linked glycans for comparative analysis

  • OST complex activity assays:

    • In vitro glycosylation assays using purified components

    • Cell-based reporter systems with glycosylation-dependent fluorescence

  • KRTCAP2 manipulation strategies:

    • CRISPR/Cas9 knockout followed by rescue experiments with mutant variants

    • siRNA knockdown (>80% efficacy achievable at 48h post-transfection)

    • Overexpression studies with tagged variants

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation to identify KRTCAP2 binding partners

    • Proximity ligation assays to visualize interactions in situ

    • Bimolecular fluorescence complementation to confirm direct interactions

How can researchers optimize antibody selection for KRTCAP2 detection?

Selecting appropriate antibodies for KRTCAP2 detection requires careful consideration:

  • Epitope selection: Target unique regions of KRTCAP2 to avoid cross-reactivity with other OST complex components

  • Species cross-reactivity: When studying bovine KRTCAP2, confirm antibody cross-reactivity, as many commercial antibodies are designed against human or mouse epitopes

  • Application-specific validation:

    • Western blot: Validate using positive controls (e.g., tissue with known high expression)

    • Immunohistochemistry: Optimize fixation conditions (paraformaldehyde typically preferred)

    • Flow cytometry: Use permeabilization buffers optimized for membrane proteins

  • Detection strategy: For recombinant KRTCAP2 with His-tag, anti-His antibodies provide reliable detection with >90% accuracy in SDS-PAGE applications

  • Multiplexing considerations: When performing multiplex immunohistochemistry (as used in tumor microenvironment studies), carefully select antibody combinations to avoid spectral overlap

What are the best approaches for studying KRTCAP2-dependent cellular phenotypes?

To effectively characterize KRTCAP2-dependent phenotypes:

  • Barrier function assessment:

    • Electric Cell-Substrate Impedance Sensing (ECIS) to monitor monolayer impedance in real-time

    • FITC-dextran flux assays to measure paracellular permeability

    • Immunofluorescent staining of junction proteins (ZO-1, claudin-1, VE-cadherin)

  • Proliferation and apoptosis:

    • Establish baseline measurements before manipulation

    • TUNEL assays can detect DNA strand breaks in specialized forms of keratinocyte apoptosis

    • Combine with Tie2 inhibition studies to assess pathway interactions

  • Immune cell interaction studies:

    • Multiplex immunohistochemistry to simultaneously visualize KRTCAP2 and immune cell markers

    • Flow cytometry to quantify immune cell populations in co-culture systems

    • Cytokine profiling to assess immune activation status

  • Cancer progression models:

    • Patient-derived xenografts with varying KRTCAP2 expression levels

    • Immunophenoscore analysis for predicting response to immune checkpoint inhibitors

How might KRTCAP2 be leveraged as a therapeutic target?

Given KRTCAP2's roles in glycosylation and potential impact on immune responses, several therapeutic strategies warrant investigation:

  • Cancer immunotherapy:

    • KRTCAP2 expression levels could serve as biomarkers for immunotherapy response prediction

    • Combining KRTCAP2 inhibition with immune checkpoint blockade may enhance efficacy

  • Targeted glycosylation modulation:

    • Selective inhibitors of KRTCAP2 might allow fine-tuning of specific glycosylation pathways

    • Structure-based drug design targeting the KRTCAP2-OST interface

  • Barrier restoration therapies:

    • Leveraging KRTCAP2's potential relationship with barrier function for treating conditions like atopic dermatitis

    • Combining with APC-based treatments that enhance barrier integrity through Tie2 activation

What comparative studies between species could reveal new insights about KRTCAP2?

Species-specific variations in KRTCAP2 structure and function remain underexplored:

  • Bovine-human comparative studies:

    • Sequence homology analysis to identify conserved functional domains

    • Interspecies complementation studies to assess functional conservation

    • Species-specific glycosylation pattern analysis

  • Evolutionary analysis:

    • Phylogenetic studies to trace KRTCAP2 evolution across species

    • Identification of species-specific adaptations in glycosylation machinery

  • Translational relevance:

    • Bovine models for studying human disease-relevant KRTCAP2 functions

    • Veterinary applications in bovine epithelial disorders

The development of bovine-specific reagents and research tools will be essential to advance this comparative understanding of KRTCAP2 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.