Recombinant Bovine Keratinocyte-associated protein 3 (KRTCAP3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. Should you require a particular format, please include this detail in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on your purchasing method and location. For specific delivery timeframes, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, we recommend briefly centrifuging the vial prior to opening, bringing the contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference point.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
We establish the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
KRTCAP3; Keratinocyte-associated protein 3; KCP-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-240
Protein Length
full length protein
Species
Bos taurus (Bovine)
Target Names
KRTCAP3
Target Protein Sequence
MRCRRLCAFDAARGPRRLMRVGLALILVGHVNLLLGAVLHGTVLRHVANPRGAVTPEYTT ANVISVGSGLLSVSLGLVALLASRNLFRPRLHWALLALALVNLLLSAACSLGLLLAVSLT VANGGRRLIADCHPGLLDPLVPLDQGSGHADCPFDPTKIYDTALALWIPSVFMSAAEAAL SGYCCVAALTLRGVGPCRKDGLQEQLEELTELEFPKRKWQENVQLLDQTREIRTSQKSWV
Uniprot No.

Target Background

Database Links
Protein Families
TMEM54 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Keratinocyte-associated Protein 3 (KRTCAP3) and what is its primary physiological role?

Keratinocyte-associated Protein 3 (KRTCAP3) is a novel gene with significant implications for adiposity regulation. Research has identified it as a candidate gene for obesity where increased expression of KRTCAP3 correlates with decreased fat mass . While initially identified through its association with keratinocytes, KRTCAP3 has demonstrated considerable influence on body weight regulation and metabolic parameters through multiple pathways.

The gene shows tissue-specific expression patterns that provide insights into its function. It is highly expressed in the pituitary gland and gastrointestinal tract of both male and female rats, with additional high expression in male gonads . This expression pattern suggests potential roles in the hypothalamic-pituitary-adrenal (HPA) axis, stress response mechanisms, and possibly along the gut-brain axis . The diversity of affected tissues indicates that KRTCAP3 may function through multiple physiological systems rather than through a single pathway.

How has the understanding of KRTCAP3 function evolved through recent research?

Studies conducted before and during the COVID-19 pandemic revealed that environmental stressors significantly impact KRTCAP3-related phenotypes, with knock-out (KO) rats showing resistance to low-grade chronic environmental stress compared to wild-type (WT) counterparts . This resistance manifested as maintained low corticosterone levels despite potentially stressful environments, suggesting that KRTCAP3 may modulate stress responses in addition to its role in metabolism .

Furthermore, investigation of sex-specific effects has revealed differential impacts of KRTCAP3 on food intake, adiposity, and insulin sensitivity between males and females, indicating complex interactions with sex hormones or sex-specific physiological pathways .

What animal models are most effective for studying KRTCAP3 function?

The primary experimental model used to investigate KRTCAP3 function is a whole-body KRTCAP3 knock-out (KO) rat model developed on the Wistar-Kyoto (WKY/NCrl) inbred rat strain . This model offers several advantages for obesity and metabolism research:

  • Rats typically display more complex metabolic and behavioral phenotypes compared to mice

  • The WKY strain provides a stable genetic background for identifying KRTCAP3-specific effects

  • Whole-body knockout allows observation of systemic effects across multiple tissue types

The development protocol involves:

  • Generation of knock-out using gene editing techniques

  • Verification through fluorescent-based fragment analysis using ABI 3730 capillary sequencer

  • Secondary confirmation through PCR amplification of KRTCAP3 over the mutation site, followed by restriction enzyme (MboI) digestion

  • Expression confirmation through rt-qPCR measurement in relevant tissues

This model has successfully demonstrated phenotypic differences between WT and KO animals, including altered body weight, feeding behavior, adiposity, and insulin sensitivity, with notable sex-specific effects .

What techniques provide the most reliable assessment of KRTCAP3 expression in different tissues?

For accurate assessment of KRTCAP3 expression across different tissues, researchers should employ the following methodological approach:

RNA Extraction and Quantification Protocol:

  • Extract RNA using Trizol for liver and other high-protein tissues

  • For brain tissue, use the Qiagen RNeasy Plus Universal mini kit following manufacturer's instructions

  • Assess RNA quality through spectrophotometry and gel electrophoresis

  • Perform reverse transcription to generate cDNA

Expression Analysis:

  • Conduct rt-qPCR with appropriate housekeeping gene controls:

    • β-actin for broad tissue analysis

    • GAPDH for metabolic tissues

  • Calculate relative expression using the 2^(-ΔΔCt) method where:

    • ΔCt = Ct(KRTCAP3) - Ct(housekeeping gene)

    • ΔΔCt = sample ΔCt - average control ΔCt

Tissue-Specific Considerations:

  • Flash-freeze tissues in liquid nitrogen immediately after collection

  • Store at -80°C until processing

  • For brain regions, perform dissection at -20°C to minimize RNA degradation

Table 1: Recommended Conditions for KRTCAP3 Expression Analysis by Tissue Type

Tissue TypeRecommended RNA Extraction MethodOptimal Housekeeping GeneSpecial Considerations
LiverTrizol-based extractionGAPDHHigh protein content may require additional purification
BrainQiagen RNeasy Plus Universal mini kitβ-actinDissection at -20°C, region-specific analysis
PituitaryQiagen RNeasy Micro kitβ-actinSmall tissue size requires specialized extraction
GastrointestinalTrizol with additional purificationGAPDH or β-actinRemoval of digestive enzymes critical
Adipose TissueQIAzol Lysis ReagentGAPDHLipid removal essential for quality RNA

How does KRTCAP3 deletion affect adiposity in a sex-specific manner?

KRTCAP3 deletion produces distinct phenotypic effects in male and female rats, revealing significant sexual dimorphism in its impact on adiposity and metabolism:

Female Phenotype:

  • Increased food intake compared to WT females

  • Significantly higher fat mass

  • Improved insulin sensitivity despite increased adiposity

Male Phenotype:

  • Increased body weight compared to WT males

  • No significant differences in food intake or fat mass

  • Decreased insulin sensitivity and increased insulin resistance

These contrasting outcomes suggest that KRTCAP3 regulates metabolism through different mechanisms in males and females. The paradoxical finding that female KO rats exhibit improved insulin sensitivity despite increased adiposity is particularly noteworthy, as it represents a decoupling of obesity from metabolic dysfunction—a phenomenon of significant interest in obesity research .

The mechanisms underlying these sex differences remain under investigation, but likely involve interactions with sex hormones, sexual dimorphism in stress response pathways, and differential tissue expression patterns, particularly the high expression of KRTCAP3 observed exclusively in male gonads .

How do researchers address contradictory data when studying KRTCAP3-mediated adiposity effects?

A significant challenge in KRTCAP3 research emerged when studies conducted before and during the COVID-19 pandemic produced different results regarding adiposity phenotypes . This contradiction provided valuable insights into environmental influences on KRTCAP3 function and demonstrates a methodological approach to addressing seemingly contradictory data:

Step 1: Document Environmental Variables

  • Researchers identified key differences between study environments:

    • Study 1 (pre-pandemic): Fully occupied facility with neighboring construction

    • Study 2 (pandemic): Minimum facility occupancy, construction completed

Step 2: Measure Stress Parameters

  • Analysis of corticosterone (CORT) levels revealed:

    • WT rats showed elevated CORT in Study 1 (higher stress environment)

    • KO rats maintained low CORT despite environmental stress

    • WT rats in Study 2 showed increased eating, body weight, and fat mass (approaching KO levels)

Step 3: Investigate Molecular Mechanisms

  • RNA-seq analysis of hypothalamic tissue identified:

    • Changes primarily affected neuronal health in WT rats between studies

    • KO rats showed resilience to environmental changes

  • Expression analysis of glucocorticoid receptor and hydroxysteroid dehydrogenases in liver and visceral fat revealed differences in CORT processing between studies

Step 4: Reinterpret Findings Through New Framework

  • Rather than viewing results as contradictory, researchers reframed their understanding:

    • KRTCAP3 deletion may confer resistance to chronic environmental stress

    • Stress response may be a primary mechanism through which KRTCAP3 influences metabolism

This methodological approach demonstrates how apparent contradictions can lead to deeper insights when researchers thoroughly document experimental conditions and investigate underlying mechanisms.

What evidence supports KRTCAP3's role in stress response pathways?

Multiple lines of evidence support KRTCAP3's involvement in stress response mechanisms:

Tissue Expression Patterns:

  • High expression in the pituitary gland of both male and female rats suggests direct involvement in the hypothalamic-pituitary-adrenal (HPA) axis, which regulates stress responses

  • Significant expression in the gastrointestinal tract indicates potential role in the gut-brain axis, which has been linked to stress response

Phenotypic Observations:

  • KO rats maintained low corticosterone (CORT) levels despite potentially stressful environments in Study 1, unlike WT rats whose CORT levels increased

  • KO rats showed no significant changes in eating behavior between different environmental conditions, while WT rats exhibited stress-induced changes

  • KO rats responded differently to acute stress during euthanasia procedures compared to WT rats, suggesting altered stress processing mechanisms

Molecular Evidence:

  • RNA-seq analysis revealed that environmental changes primarily affected neuronal health of WT rats while KO rats showed resilience

  • Differential expression of glucocorticoid receptor and hydroxysteroid dehydrogenases in liver and visceral fat suggest altered stress hormone processing in KO animals

Collectively, these findings suggest that KRTCAP3 may function as a modulator of stress responses, potentially explaining its observed effects on feeding behavior, body weight regulation, and metabolic parameters.

How can researchers design experiments to differentiate between KRTCAP3's direct metabolic effects versus stress-mediated effects?

To distinguish between direct metabolic effects and stress-mediated effects of KRTCAP3, researchers should implement the following experimental design elements:

Controlled Environmental Conditions:

  • Maintain identical housing conditions with detailed documentation of:

    • Temperature, humidity, light cycles

    • Facility occupancy and activity levels

    • Potential stressors (construction, noise, handling procedures)

Stress Parameter Assessments:

  • Implement regular stress monitoring through:

    • Baseline and stress-induced corticosterone measurements

    • Behavioral assessments of stress (open field test, elevated plus maze)

    • Heart rate and blood pressure monitoring during procedures

  • Include positive and negative stress control groups

Tissue-Specific Knockout Models:

  • Develop conditional knockout models targeting:

    • Hypothalamus and pituitary (stress response)

    • Liver and adipose tissue (metabolic regulation)

    • Gastrointestinal tract (feeding behavior)

  • Compare phenotypes between tissue-specific and whole-body knockouts

Pharmacological Interventions:

  • Administer glucocorticoid receptor antagonists to block stress hormone signaling

  • Implement stress hormone supplementation to normalize levels between groups

  • Compare metabolic outcomes under these conditions

Data Analysis Framework:

Table 2: Experimental Framework for Differentiating KRTCAP3 Effects

ParameterDirect Metabolic EffectStress-Mediated EffectCombined Effect
Body weight changesPresent under stress-controlled conditionsMinimal under stress-controlled conditionsPresent in standard conditions
Food intakeChanges persist with normalized CORTChanges disappear with normalized CORTVariable by condition
Insulin sensitivityPresent with GR blockadeDisappears with GR blockadePresent in standard conditions
Glucose metabolismChanges in tissue-specific liver KONo changes in tissue-specific liver KOPresent in whole-body KO
Fat redistributionPresent regardless of stress stateVaries with stress statePresent in standard conditions

This comprehensive approach allows researchers to systematically dissect the direct metabolic effects of KRTCAP3 from those mediated through stress response pathways.

How can transcriptomic approaches enhance our understanding of KRTCAP3 mechanism of action?

Transcriptomic approaches offer powerful tools for elucidating KRTCAP3's mechanism of action through comprehensive gene expression analysis:

RNA-Seq Implementation:

  • Sample preparation protocol:

    • Extract total RNA from fresh frozen tissue samples using appropriate extraction methods for each tissue type

    • Quantify RNA and assess quality using bioanalyzer or similar technology

    • Prepare libraries with polyA selection to focus on mRNA transcripts

  • Experimental design considerations:

    • Include multiple biological replicates (minimum n=3 per group)

    • Compare WT vs. KO under both basal and stressed conditions

    • Include tissue-specific samples from high-expression areas (pituitary, gastrointestinal tract, gonads)

Analytical Approaches:

  • Differential expression analysis to identify:

    • Direct targets of KRTCAP3 regulation

    • Pathway enrichment patterns

    • Sex-specific expression differences

  • Co-expression network analysis to reveal:

    • Functional gene modules associated with KRTCAP3

    • Hub genes that may mediate KRTCAP3 effects

    • Regulatory relationships between genes

  • Integration with other -omics data:

    • Proteomics to confirm translational impacts

    • Metabolomics to identify affected metabolic pathways

    • Epigenomics to assess regulatory mechanisms

Previous Research Findings:
RNA-seq analysis of hypothalamic tissue from female rats revealed that environmental changes between studies primarily affected neuronal health of WT rats, while KO rats showed resilience . This suggests KRTCAP3 deletion may protect against stress-induced neuronal changes, potentially explaining the observed resistance to environmental stress.

What are the most promising future research directions for understanding KRTCAP3 function?

Based on current findings, several promising research directions emerge for advancing our understanding of KRTCAP3 function:

Molecular Mechanism Elucidation:

  • Identification of KRTCAP3 protein interaction partners through:

    • Co-immunoprecipitation followed by mass spectrometry

    • Yeast two-hybrid screening

    • Proximity labeling approaches

  • Determination of subcellular localization and trafficking patterns

Tissue-Specific Functions:

  • Development of conditional tissue-specific knockout models to isolate:

    • Pituitary-specific effects on stress response

    • Gastrointestinal effects on feeding behavior

    • Gonad-specific effects on sex differences

  • Tissue-specific transcriptomic and proteomic profiling

Stress-Metabolism Interface:

  • Investigation of KRTCAP3's role in integrating stress and metabolic signals through:

    • Challenge studies combining metabolic and stress stimuli

    • Longitudinal monitoring of HPA axis parameters and metabolic outcomes

    • Pharmacological manipulation of stress pathways

Translational Research:

  • Exploration of human KRTCAP3 variants and their association with:

    • Obesity phenotypes

    • Stress resilience

    • Sex-specific metabolic parameters

  • Development of targeted interventions based on KRTCAP3 pathways

These research directions will not only advance our fundamental understanding of KRTCAP3 biology but may also identify novel therapeutic targets for obesity, stress-related disorders, and metabolic dysfunction.

How should researchers account for environmental variability when interpreting KRTCAP3 study results?

The documented environmental influences on KRTCAP3-related phenotypes necessitate rigorous methodological approaches to data interpretation:

Environmental Documentation Protocol:

Statistical Analysis Framework:

  • Outlier detection and management:

    • Apply Grubbs' test when sample size exceeds 6

    • Use interquartile range method for smaller samples

    • Document and justify any data exclusions

  • Assess data normality through:

    • Shapiro-Wilk test

    • Visual inspection of Q-Q plots

    • Evaluate homogeneity of variance using Bartlett test

  • Implement appropriate statistical models:

    • Include environmental parameters as covariates

    • Consider mixed-effects models for longitudinal data

    • Account for potential batch effects

Replication and Validation:

  • Conduct studies across different:

    • Environmental conditions

    • Animal facilities

    • Seasons/time periods

    • Research teams

  • Establish minimum environmental reporting standards for publication

The study comparing pre-pandemic and pandemic conditions provides an excellent example of how environmental factors can influence experimental outcomes in KRTCAP3 research . By implementing these methodological approaches, researchers can more accurately interpret results and distinguish KRTCAP3-specific effects from environmental confounds.

What are the key considerations for designing reproducible KRTCAP3 knockout studies?

Designing reproducible KRTCAP3 knockout studies requires attention to several critical factors:

Genetic Considerations:

  • Genetic background standardization:

    • Maintain consistent inbred strain (e.g., WKY/NCrl)

    • Document generation number and breeding scheme

    • Consider backcrossing to refresh genetic background

  • Knockout validation:

    • Implement multiple verification methods (fluorescent fragment analysis, restriction enzyme digestion)

    • Confirm reduced expression through rt-qPCR in relevant tissues

    • Assess potential compensatory mechanisms

Experimental Design Elements:

  • Power analysis to determine appropriate sample sizes:

    • Account for expected effect sizes based on previous studies

    • Consider sex as a biological variable

    • Plan for potential attrition

  • Randomization and blinding:

    • Randomize cage placement and treatment assignment

    • Implement blinded assessment of outcomes

    • Consider automated measurement systems to reduce bias

  • Control implementation:

    • Include littermate controls when possible

    • Consider heterozygous groups to assess gene dosage effects

    • Implement sham procedures for all experimental manipulations

Data Collection Standardization:

  • Establish standard operating procedures for:

    • Body composition analysis

    • Food intake measurement

    • Glucose and insulin tolerance testing

    • Tissue collection and processing

    • Stress parameter assessment

  • Implement quality control checkpoints throughout the experimental workflow

Reporting Standards:

  • Comprehensive methodology documentation:

    • Detailed environmental conditions

    • Complete genetic characterization

    • All experimental procedures with timing

    • Statistical analysis plan registered before study initiation

  • Data sharing practices:

    • Raw data availability

    • Analysis code publication

    • Detailed phenotyping protocols

By addressing these considerations, researchers can enhance the reproducibility of KRTCAP3 knockout studies and facilitate more reliable cross-study comparisons.

How might findings from KRTCAP3 research translate to human obesity and metabolic disorders?

KRTCAP3 research has several potential translational implications for human obesity and metabolic disorders:

Novel Pathway Identification:
KRTCAP3 studies have revealed a potential mechanism for obesity without metabolic complications, as observed in female KO rats that display increased adiposity with improved insulin sensitivity . This phenomenon resembles the "metabolically healthy obesity" phenotype observed in some human populations and could lead to identification of protective pathways that prevent metabolic dysfunction despite increased adiposity.

Sex-Specific Treatment Approaches:
The marked sexual dimorphism in KRTCAP3 effects suggests that obesity treatments may need to be tailored differently for males and females . This aligns with growing recognition of sex differences in human metabolic disorders and supports the development of sex-specific therapeutic approaches.

Stress-Metabolism Connections:
The evidence linking KRTCAP3 to stress response offers new insights into how chronic stress may contribute to obesity . This connection is particularly relevant given the well-documented but poorly understood relationship between stress and weight gain in humans, potentially leading to stress-management interventions as part of obesity treatment.

Genetic Risk Assessment:
Identification of human KRTCAP3 variants associated with adiposity could contribute to genetic risk profiling for obesity and related disorders. The study noting that KRTCAP3 may be a pleiotropic gene for obesity, type 2 diabetes, and dyslipidemia in humans supports this potential application .

What methodological approaches can determine if KRTCAP3 represents a viable therapeutic target?

Establishing KRTCAP3 as a viable therapeutic target requires a systematic approach:

Target Validation Framework:

  • Human genetic evidence:

    • Genome-wide association studies to link KRTCAP3 variants with obesity phenotypes

    • Exome sequencing to identify rare variants with large effects

    • Expression quantitative trait loci (eQTL) analysis to connect gene expression to phenotype

  • Functional characterization:

    • Development of cell-based assays for KRTCAP3 function

    • Identification of measurable endpoints for high-throughput screening

    • Determination of structure-function relationships

  • Therapeutic modulation assessment:

    • Small molecule screening to identify modulators

    • Antisense oligonucleotide or siRNA approaches to reduce expression

    • PROTAC (proteolysis targeting chimera) technology for protein degradation

    • Evaluation of tissue-specific delivery methods

Efficacy and Safety Evaluation:

  • Preclinical efficacy studies:

    • Multiple animal models (diet-induced obesity, genetic models)

    • Sex-specific assessment of outcomes

    • Long-term treatment studies to assess durability

  • Safety assessment:

    • Evaluation of effects on stress response systems

    • Assessment of potential compensatory mechanisms

    • Sex-specific safety profiling

    • Dose-response relationships to identify therapeutic window

Biomarker Development:

  • Identification of pharmacodynamic markers:

    • Measurable changes in stress hormones

    • Alterations in metabolic parameters

    • Tissue-specific molecular signatures

  • Patient stratification markers:

    • Genetic variants predicting response

    • Baseline stress parameters

    • Sex-specific indicators

This methodological framework provides a roadmap for determining whether KRTCAP3 represents a viable therapeutic target for obesity and related metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.