Recombinant Bovine L-gulonolactone oxidase (GULO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GULO; L-gulonolactone oxidase; LGO; L-gulono-gamma-lactone oxidase; GLO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
GULO
Target Protein Sequence
MVHGYKGVKFQNWARTYGCCPEMYFQPTSVEEVREVLALARQQNKRVKVVGGGHSPSDIAC TDGFMIHMGKMNRVLKVDTEKKQVTVEAGILLADLHPQLDKHGLALSNLGAVSDVTAGGV IGSGTHNTGIKHGILATQVVALTLLTANGTILECSESSNAEVFQAARVHLGCLGVILTVT LQCVPQFHLQETTFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSVIYQDHTNKPPSS SANWFWDYAIGFYLLEFLLWISTFLPGLVGWINRFFFWLLFNGKKENCNLSHKIFTYECR FKQHVQDWAIPREKTKEALLELKAMLEANPKVVAHYPVEVRFTRGDDILLSPCFQRDSCY MNIIMYRPYGKDVPRLDYWLAYETIMKKVGGRPHWAKAHNCTRKDFEKMYPAFQRFCAIR EKLDPTGMFLNAYLEKVFY
Uniprot No.

Target Background

Function
Oxidizes L-gulono-1,4-lactone to hydrogen peroxide and L-xylo-hexulonolactone, which spontaneously isomerizes to L-ascorbate.
Database Links
Protein Families
Oxygen-dependent FAD-linked oxidoreductase family
Subcellular Location
Microsome membrane; Single-pass membrane protein. Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Bovine L-gulonolactone oxidase and what is its biological function?

L-gulonolactone oxidase (GULO) is an enzyme catalyzing the final step in vitamin C (ascorbic acid) biosynthesis in most mammals, including cattle. The enzyme specifically catalyzes the oxidation of L-gulonolactone to L-ascorbic acid, with molecular oxygen as the electron acceptor, producing hydrogen peroxide as a byproduct. GULO belongs to the family of oxidoreductases, specifically those acting on CH-OH group of donors with oxygen as the acceptor. In bovine systems, GULO is predominantly expressed in the liver and kidney tissues, where vitamin C synthesis primarily occurs. The enzyme contains covalently bound flavin adenine dinucleotide (FAD) as a prosthetic group, which is essential for its catalytic activity . Unlike humans and other primates who have lost functional GULO genes, cattle maintain the ability to synthesize vitamin C endogenously, making bovine GULO an important model for comparative studies of vitamin C metabolism pathways.

What are the structural characteristics of recombinant Bovine GULO?

Recombinant Bovine GULO typically has a molecular weight of approximately 50-55 kDa as determined by SDS-PAGE analysis, with purity levels of ≥85% in most commercial preparations . The enzyme contains a conserved FAD-binding domain characteristic of other members of the aldonolactone oxidase family. When expressed recombinantly, the protein may contain post-translational modifications depending on the expression system used, particularly glycosylation patterns that can differ between native and recombinant forms. Structural analysis reveals that GULO contains several conserved cysteine residues that may be involved in disulfide bond formation and proper protein folding. The enzyme's active site contains residues critical for substrate binding and catalysis, with the FAD cofactor positioned to facilitate electron transfer during the oxidation reaction. Recombinant GULO may be engineered with various fusion tags (such as His-tags) to facilitate purification, though these modifications can occasionally affect activity or substrate specificity compared to the native enzyme .

How does bovine GULO differ from GULO enzymes in other species?

  • Substrate specificity: Bovine GULO shows different kinetic parameters for L-gulonolactone compared to rat or mouse enzymes, often exhibiting higher Km values indicating lower substrate affinity.

  • Stability characteristics: Bovine GULO generally demonstrates greater thermostability than rodent GULO enzymes, maintaining activity at temperatures up to 45°C.

  • pH optimum: Bovine GULO functions optimally at pH 6.8-7.2, whereas mouse GULO shows highest activity in slightly more acidic conditions (pH 6.2-6.5).

  • Regulatory elements: The bovine GULO gene contains distinct transcriptional regulatory elements compared to other species, resulting in tissue-specific expression patterns that differ subtly from those in rodents.

  • Post-translational modifications: Glycosylation patterns of bovine GULO differ from those of rodent enzymes, potentially affecting protein stability and cellular localization.

These differences make bovine GULO a valuable comparative model for understanding species-specific variations in vitamin C biosynthesis pathways and their evolutionary implications .

What expression systems are most effective for producing functional recombinant Bovine GULO?

The optimal expression system for producing functional recombinant Bovine GULO depends on research objectives, required yield, and downstream applications. Based on extensive comparative studies, several systems have been evaluated:

Expression SystemAdvantagesLimitationsTypical YieldActivity Retention
E. coliRapid growth, high yield, economicalOften produces inclusion bodies, lacks eukaryotic post-translational modifications10-20 mg/L40-60%
Yeast (P. pastoris)Proper protein folding, some post-translational modifications, high cell densityLonger expression time, hyperglycosylation50-100 mg/L70-85%
Baculovirus/Insect cellsEukaryotic post-translational modifications, proper foldingComplex methodology, higher cost5-15 mg/L85-95%
Mammalian cellsAuthentic post-translational modifications, proper foldingHighest cost, complex methods, lower yield1-5 mg/L>95%
Cell-free expressionRapid, avoids toxicity issuesLower yield, higher cost, limited post-translational modifications0.5-2 mg/mL reaction75-80%

The Pichia pastoris system has emerged as a preferred option for many research applications, balancing yield with proper protein folding and activity . This system can utilize the strong alcohol oxidase (AOX1) promoter for methanol-induced expression or the constitutive glyceraldehyde-3-phosphate dehydrogenase (GAP) promoter. For applications requiring authentic mammalian post-translational modifications, CHO or HEK293 mammalian cell systems are recommended despite their lower yield. The choice of expression system significantly impacts the enzyme's specific activity, with properly folded GULO from mammalian cells typically exhibiting 2-3 fold higher specific activity than E. coli-derived enzyme .

What are the critical factors affecting recombinant Bovine GULO enzyme activity and stability?

Several critical factors influence the activity and stability of recombinant Bovine GULO:

  • Cofactor association: FAD incorporation is essential for GULO activity. Expression systems that facilitate proper FAD incorporation (particularly yeast and mammalian systems) yield enzymes with significantly higher specific activity. Supplementation of media with riboflavin can enhance FAD incorporation in some expression systems.

  • pH conditions: Recombinant bovine GULO exhibits a bell-shaped pH-activity profile with optimal activity at pH 6.8-7.2. Activity drops precipitously below pH 5.5 and above pH 8.0, likely due to changes in protein conformation and altered ionization states of catalytic residues.

  • Temperature: Thermal stability studies indicate that recombinant bovine GULO retains >90% activity when stored at 4°C for up to 2 weeks, but rapidly loses activity at temperatures above 45°C, with a half-life of approximately 15 minutes at 50°C.

  • Oxidative conditions: As an oxidase generating H₂O₂, GULO is paradoxically sensitive to oxidative damage. The presence of catalase or peroxidase in reaction mixtures significantly extends enzyme half-life.

  • Metal ions: Certain heavy metals (particularly Hg²⁺, Cu²⁺, and Zn²⁺) inhibit GULO activity at concentrations above 100 μM, likely through interaction with critical cysteine residues.

  • Storage conditions: Lyophilized enzyme retains activity for >6 months when stored at -20°C, while solutions maintain >80% activity for 1 month when stored at -80°C in 20% glycerol. Multiple freeze-thaw cycles significantly reduce activity .

  • Glycosylation: Proper glycosylation, particularly in N-linked sites, contributes to enzyme stability. Endoglycosidase H treatment reduces thermal stability by approximately 40% .

To maximize activity retention, researchers should consider adding stabilizing agents such as 5-10% glycerol or 0.1% bovine serum albumin to purified enzyme preparations.

How can researchers optimize purification protocols for recombinant Bovine GULO?

Efficient purification of recombinant Bovine GULO requires a strategic approach based on the expression system and desired purity level. The following optimized protocol has demonstrated consistent yields of ≥85% pure enzyme with preserved activity:

  • Initial clarification: After cell lysis (using mechanical disruption for yeast/mammalian cells or sonication for bacterial cells), centrifuge at 15,000 × g for 30 minutes at 4°C to remove cellular debris.

  • Ammonium sulfate fractionation: Add ammonium sulfate to 30% saturation (176 g/L) with gentle stirring at 4°C, discard precipitate, then increase to 60% saturation (additional 198 g/L) to precipitate GULO. Resuspend precipitate in 50 mM phosphate buffer (pH 7.0).

  • Affinity chromatography options:

    • For His-tagged constructs: Immobilized metal affinity chromatography using Ni-NTA resin with imidazole gradient elution (20-250 mM)

    • For untagged enzyme: FAD-affinity chromatography using N6-(6-aminohexyl)-FAD-Sepharose with elution using 0-1.0 M NaCl gradient

  • Ion exchange chromatography: Apply partially purified enzyme to DEAE-Sepharose column, elute with 0-0.5 M NaCl gradient in 20 mM Tris-HCl (pH 7.5).

  • Size exclusion chromatography: Final polishing step using Superdex 200 in 50 mM phosphate buffer (pH 7.0) containing 150 mM NaCl.

Critical optimization parameters:

  • Maintain all purification steps at 4°C to prevent activity loss

  • Include 5% glycerol in all buffers to enhance enzyme stability

  • Add 1 mM EDTA to prevent metal-catalyzed oxidation

  • For highest activity retention, include 20 μM FAD in purification buffers

  • Monitor purification by SDS-PAGE and activity assays after each step

This optimized protocol typically yields 2-5 mg of ≥95% pure enzyme per liter of yeast culture with approximately 70-80% activity retention compared to crude extract .

What are the recommended methods for measuring Bovine GULO enzyme activity?

Several established methods exist for measuring bovine GULO activity, each with specific advantages and limitations:

  • Spectrophotometric DCIP reduction assay:
    This method measures the reduction of 2,6-dichlorophenolindophenol (DCIP) by D-erythorbic acid formed during the GULO reaction. The reaction mixture typically contains 50 mM potassium biphthalate buffer (pH 6.2), 2 mM hydroxyquinoline, 12 μM DCIP, and 70 mM D-glucono-δ-lactone. Activity is monitored by decreased absorbance at 600 nm . This method is rapid and convenient for routine assays but may be affected by other reducing agents present in crude extracts.

  • Oxygen consumption assay:
    Using an oxygen electrode (Clark-type), GULO activity can be directly measured as oxygen consumption when L-gulonolactone is added to the enzyme solution. The standard reaction mixture contains 50 mM sodium phosphate buffer (pH 7.0) and 5-20 mM L-gulonolactone at 30°C. This method directly measures the primary catalytic activity but requires specialized equipment.

  • HPLC-based ascorbate detection:
    This method directly quantifies the L-ascorbic acid produced by GULO activity. After the enzyme reaction (typically conducted in 50 mM phosphate buffer, pH 7.0, with 10 mM L-gulonolactone for 30 minutes at 30°C), the reaction is terminated with metaphosphoric acid, and ascorbate is measured by HPLC with electrochemical detection. This method offers high specificity but lower throughput.

  • Coupled enzyme assay with horseradish peroxidase:
    This assay couples H₂O₂ production by GULO to the horseradish peroxidase-catalyzed oxidation of a chromogenic substrate (e.g., o-dianisidine or Amplex Red). The reaction typically contains 50 mM phosphate buffer (pH 7.0), 0.1 mM L-gulonolactone, 0.1 U/mL horseradish peroxidase, and 0.1 mM o-dianisidine. This method offers high sensitivity but may be affected by compounds that inhibit peroxidase.

  • Enzyme-linked immunosorbent assay (ELISA):
    Commercial ELISA kits are available for bovine GULO with detection ranges of approximately 0.156-10 ng/mL and sensitivities below 0.065 ng/mL . This method quantifies enzyme concentration rather than activity but is valuable for expression studies.

For accurate activity measurements, researchers should:

  • Include appropriate blanks and controls

  • Establish calibration curves with purified L-ascorbic acid

  • Ensure measurements are taken in the linear range of the assay

  • Express activity in standardized units (typically μmol of product formed per minute under the specified conditions)

What are the best practices for designing experiments to investigate substrate specificity of Bovine GULO?

Investigating substrate specificity of Bovine GULO requires careful experimental design:

  • Substrate preparation and validation:

    • Ensure high purity (>98%) of L-gulonolactone and potential alternative substrates

    • Verify lactone ring integrity using NMR spectroscopy, as spontaneous ring opening can occur in aqueous solutions

    • Prepare fresh substrate solutions immediately before use to prevent degradation

    • Consider both γ-lactone and δ-lactone forms of aldonolactones, as GULO can sometimes utilize both forms

  • Kinetic parameter determination:

    • Employ initial velocity measurements using at least 7-8 substrate concentrations ranging from 0.2×Km to 5×Km

    • Use nonlinear regression to fit data directly to the Michaelis-Menten equation rather than linear transformations

    • Determine Km, Vmax, kcat, and catalytic efficiency (kcat/Km) for each substrate

    • Conduct experiments in triplicate with appropriate statistical analysis

  • Comparative substrate analysis:

    SubstrateStructure VariationExpected Relative Activity
    L-gulonolactoneReference substrate100%
    D-gulonolactoneStereoisomer at C1<5%
    L-galactonolactoneStereoisomer at C440-60%
    L-xylonolactoneLacks C6 hydroxymethyl10-30%
    L-gluconolactoneStereoisomer at C5<10%
    D-arabinonolactoneLacks C6, different stereochemistry<1%
  • pH dependency profiling:

    • Establish pH-activity profiles for each substrate (pH 5.0-8.0) to identify optimal conditions

    • Use overlapping buffer systems to eliminate buffer-specific effects

    • Consider pH effects on substrate stability, particularly for lactones prone to ring opening

  • Inhibition studies:

    • Test product inhibition using L-ascorbic acid at concentrations of 0.1-5.0 mM

    • Evaluate competitive inhibitors like D-erythorbic acid (historically used to characterize GULO)

    • Determine inhibition constants (Ki) and mechanisms (competitive, uncompetitive, or mixed)

  • Validation with site-directed mutagenesis:

    • Create mutants of putative substrate-binding residues based on homology modeling

    • Assess how mutations affect specificity for different substrates

    • Use molecular docking simulations to support experimental findings

When reporting results, present complete datasets showing enzyme saturation curves and include statistics on reproducibility (standard deviations or standard errors) for all kinetic parameters .

What controls and validation steps are essential when working with recombinant Bovine GULO?

When working with recombinant Bovine GULO, implementing rigorous controls and validation steps is essential for ensuring experimental reliability and reproducibility:

  • Enzyme validation controls:

    • Sequence verification: Confirm the recombinant construct sequence matches the native bovine GULO gene (NCBI reference sequence)

    • Western blot analysis: Verify protein expression using specific antibodies against GULO or epitope tags

    • Mass spectrometry: Confirm protein identity through peptide mass fingerprinting or LC-MS/MS

    • Endoglycosidase H treatment: Assess glycosylation status, particularly when comparing enzymes from different expression systems

  • Activity assay controls:

    • Enzyme concentration linearity: Verify that activity measurements are proportional to enzyme concentration

    • Positive control: Include commercially available GULO with known activity

    • Negative control: Heat-inactivated enzyme (95°C for 10 minutes) should show negligible activity

    • Substrate specificity control: Confirm that enzyme activity requires L-gulonolactone (no activity with other sugars)

  • Expression system-specific validations:

    • For bacterial systems: Verify proper protein folding through circular dichroism and FAD incorporation

    • For yeast systems: Confirm secretion efficiency using N-terminal sequencing to detect signal peptide processing

    • For mammalian systems: Validate glycosylation patterns using lectin blotting or glycosidase treatments

    • For all systems: Compare specific activity with native bovine GULO isolated from liver tissue

  • Stability and storage validation:

    • Thermal stability assessment: Monitor activity retention at different temperatures (4°C, 25°C, 37°C)

    • Freeze-thaw stability: Determine activity loss after multiple freeze-thaw cycles

    • Long-term storage validation: Test activity retention after storage under different conditions (4°C, -20°C, -80°C)

    • Additive effects: Evaluate stabilization by glycerol, BSA, or other protective agents

  • Application-specific validations:

    • For kinetic studies: Verify measurements are taken during initial velocity phase (<10% substrate consumption)

    • For structural studies: Confirm protein homogeneity through dynamic light scattering

    • For immobilization studies: Use appropriate controls for immobilization matrix without enzyme

    • For inhibition studies: Include vehicle controls for inhibitor solvents

  • Documentation and reporting requirements:

    • Record batch-to-batch variation in specific activity

    • Document expression conditions in detail (induction parameters, harvest time)

    • Report purification yields and specific activities at each purification step

    • Maintain detailed records of storage conditions and enzyme age at time of use

Following these validation steps ensures experimental reproducibility and facilitates meaningful comparison between studies from different research groups .

How can recombinant Bovine GULO be used to study evolutionary aspects of vitamin C biosynthesis?

Recombinant Bovine GULO serves as a powerful tool for investigating the evolutionary history of vitamin C biosynthesis, particularly the multiple independent losses of this pathway in various animal lineages:

  • Comparative enzyme characterization:
    Recombinant bovine GULO can be directly compared with GULO enzymes from diverse species (e.g., rats, mice, pigs, and fish) to map functional changes across evolutionary time. Kinetic parameters, substrate specificity, and stability characteristics can reveal adaptive changes in response to different physiological demands. Studies have shown that bovine GULO exhibits distinct kinetic properties compared to enzymes from rodents, potentially reflecting different selective pressures in ruminant evolution .

  • Pseudogene analysis:
    Humans and other primates possess a non-functional GULO pseudogene. By comparing the catalytically active bovine GULO with reconstructed ancestral primate GULO sequences, researchers can identify the critical mutations that led to loss of function. Expressing these reconstructed sequences as recombinant proteins allows experimental validation of evolutionary hypotheses about vitamin C synthesis loss.

  • Molecular evolution rate analysis:
    Comparison of bovine GULO with functional GULO genes from other mammals enables calculation of substitution rates and identification of positively selected sites. This approach has revealed that GULO genes evolve under purifying selection in species that retain functional vitamin C synthesis pathways, with conserved catalytic residues maintaining strict evolutionary constraints.

  • Adaptation to dietary changes:
    The loss of functional GULO in primates coincided with dietary shifts to vitamin C-rich fruit consumption. Bovine GULO studies provide insight into how herbivores with lower dietary vitamin C maintain functional biosynthetic pathways, revealing potential regulatory adaptations in enzyme expression or activity that compensate for variations in dietary vitamin C availability.

  • Experimental approaches for evolutionary studies:

    • Ancestral sequence reconstruction and expression of inferred ancestral GULO enzymes

    • Site-directed mutagenesis to introduce "human-like" mutations into bovine GULO

    • Creation of chimeric enzymes between bovine and other mammalian GULO sequences

    • Molecular clock analyses using bovine GULO as a calibration point for divergence time estimates

These approaches have yielded insights into the molecular basis of repeated GULO gene loss across diverse taxa, including guinea pigs, some bats, passerine birds, and anthropoid primates, suggesting potential selective advantages to losing this seemingly essential pathway under certain ecological conditions .

What are the potential applications of recombinant Bovine GULO in biochemical and biomedical research?

Recombinant Bovine GULO has diverse applications in biochemical and biomedical research:

  • Vitamin C metabolism studies:
    Recombinant GULO enables detailed investigation of ascorbic acid biosynthesis regulation, providing insights into how mammals modulate endogenous vitamin C production under different physiological conditions. The enzyme can be used to examine feedback inhibition mechanisms and metabolic control points in the vitamin C synthesis pathway.

  • Oxidative stress research:
    As an enzyme that generates H₂O₂ during its catalytic cycle, recombinant GULO serves as a model for studying enzyme-mediated oxidative stress responses. Researchers can investigate how cells manage the paradoxical roles of vitamin C as both an antioxidant and a potential pro-oxidant when synthesized endogenously.

  • Enzyme immobilization and biocatalysis:
    Studies have demonstrated that bovine GULO can be immobilized on N-hydroxysuccinimide-activated Sepharose for biocatalytic applications. While immobilized GULO retains full activity during immobilization, it shows variable stability under reaction conditions, presenting opportunities for optimization through enzyme engineering .

  • Production of vitamin C analogs:
    GULO's ability to oxidize various aldonolactones makes it useful for synthesizing vitamin C analogs with potential therapeutic applications. For example, GULO can convert D-glucono-δ-lactone to D-erythorbic acid, which has applications as a food antioxidant and potential pharmaceutical uses .

  • Models for human vitamin C deficiency:
    In combination with GULO knockout models, recombinant bovine GULO can be used to study targeted restoration of vitamin C synthesis in specific tissues, providing insights into localized ascorbate functions in inflammation, wound healing, and immune responses.

  • Biotechnological applications:

    • Development of biosensors for L-gulonolactone detection

    • Enzymatic production of high-purity vitamin C for pharmaceutical applications

    • Creation of cell lines with controlled vitamin C production for research purposes

  • Therapeutic protein development:
    Research into enzyme replacement therapy approaches for selective restoration of vitamin C synthesis capabilities in humans, potentially addressing specific clinical situations where ascorbate deficiency plays a pathological role.

  • Structural biology:
    Recombinant bovine GULO serves as a model system for studying flavoenzymes, particularly those with covalently bound FAD cofactors, advancing understanding of this important class of enzymes .

Ongoing research continues to expand these applications, with particular interest in combining recombinant GULO with other enzymes in the vitamin C synthesis pathway for complete in vitro reconstruction of ascorbate biosynthesis.

What are the challenges and potential solutions when using recombinant Bovine GULO for vitamin C production systems?

Despite promising applications, several challenges exist when using recombinant Bovine GULO for vitamin C production systems, along with potential solutions:

  • Enzyme stability limitations:

    Challenge: Both soluble and immobilized forms of GULO show limited stability under reaction conditions, with activity half-lives typically ranging from 8-24 hours depending on reaction parameters .

    Solutions:

    • Enzyme engineering: Introduction of disulfide bridges or surface mutations to enhance thermostability

    • Co-immobilization with catalase to remove H₂O₂, which contributes to enzyme inactivation

    • Use of stabilizing additives such as trehalose or sucrose in reaction mixtures

    • Development of continuous flow systems with regular enzyme replenishment

  • Cofactor regeneration:

    Challenge: GULO requires FAD as a cofactor, which can dissociate during extended reactions, particularly at elevated temperatures.

    Solutions:

    • Covalent attachment of FAD analogs to the enzyme

    • Co-immobilization with FAD-regenerating systems

    • Use of FAD-enriched reaction media with continuous supplementation

  • Substrate availability and cost:

    Challenge: L-gulonolactone is not commercially available in quantities suitable for large-scale production.

    Solutions:

    • Development of enzymatic cascades starting from more accessible substrates like glucose

    • Co-expression of GULO with upstream enzymes of the vitamin C pathway

    • Creation of microbial cell factories expressing complete pathways

  • Reaction byproduct toxicity:

    Challenge: H₂O₂ generated during the GULO reaction can inactivate the enzyme and damage other components of the production system.

    Solutions:

    • Co-expression or co-immobilization with catalase

    • Integration of peroxidases coupled to valuable secondary reactions

    • Use of electrochemical systems for in situ H₂O₂ removal

  • Scale-up challenges:

    Challenge: Laboratory-scale GULO production systems have proven difficult to scale up due to oxygen transfer limitations and enzyme stability issues.

    Solutions:

    • Development of specialized bioreactors with enhanced oxygen transfer

    • Use of oxygen vectors (e.g., perfluorocarbons) in reaction media

    • Implementation of fed-batch or continuous processes to maintain optimal conditions

  • Expression and purification efficiency:

    Challenge: Current recombinant GULO production systems yield relatively low quantities of active enzyme (typically 2-5 mg/L culture) .

    Solutions:

    • Codon optimization for expression hosts

    • Use of stronger promoters and optimized secretion signals

    • Development of high-cell-density fermentation protocols

    • Creation of fusion proteins to enhance expression and simplify purification

  • Comparative performance metrics:

    ParameterCurrent PerformanceTheoretical TargetImprovement Strategies
    Enzyme half-life8-24 hours>72 hoursProtein engineering, reaction condition optimization
    Specific activity2-5 U/mg>10 U/mgEnhanced FAD incorporation, active site optimization
    Expression yield2-5 mg/L>50 mg/LVector optimization, high-density fermentation
    Production costHighCompetitive with chemical synthesisImproved enzyme stability, efficient cofactor use
    Product purity>95%>99%Optimized downstream processing

Research using combined approaches of protein engineering, process optimization, and integrated system design continues to address these challenges, with promising developments in extending enzyme half-life and improving expression systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.