Recombinant Bovine L-selectin (SELL)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Biological Role

Bovine L-selectin shares structural homology with human and mouse variants, featuring:

  • N-terminal C-type lectin domain for carbohydrate recognition

  • Epidermal growth factor-like domain for ligand binding

  • Short cytoplasmic tail involved in intracellular signaling

As a cell adhesion molecule, it mediates leukocyte rolling on endothelial surfaces and facilitates lymphocyte homing to lymphoid tissues .

Expression Systems and Key Findings

Recombinant bovine L-selectin has been expressed in two heterologous systems:

Host SystemVector/TagExpression OutcomeDetection Method
Escherichia colipGEX (GST fusion)Insoluble 60 kDa fusion proteinSDS-PAGE, Western blot (anti-CD62L)
Insect cells (Sf9)BaculovirusSurface-expressed functional proteinFlow cytometry, immunofluorescence
  • Bacterial expression yielded insoluble protein requiring refolding for functional studies .

  • Insect cell expression achieved proper membrane localization, enabling adhesion and signaling assays .

Antibody Reactivity and Applications

  • Recombinant bovine L-selectin reacted with anti-bovine CD62L monoclonal antibodies, confirming antigenic fidelity .

  • Flow cytometry showed 66% of bovine peripheral blood mononuclear cells (PBMCs) express endogenous L-selectin, validating its role in immune cell trafficking .

  • Surface expression on transfected Sf9 cells enabled ligand-binding studies and antibody production for diagnostic tools .

Comparative Insights Across Species

FeatureBovine Human Mouse
Expression HostsE. coli, insect cellsHEK293, CHO cellsHEK293 cells
Molecular Weight60 kDa (GST fusion)74–100 kDa (glycosylated)~75 kDa (His/Fc-tagged)
Key ApplicationsAntiserum developmentLeukocyte adhesion assaysInflammation models

Research Implications

  • Therapeutic targeting: Insights into L-selectin shedding mechanisms (e.g., ADAM17-mediated cleavage) inform anti-inflammatory drug design .

  • Viral pathogenesis: HIV-1 exploits L-selectin for T-cell adhesion, highlighting its role in viral entry .

  • Agricultural immunology: Enhances understanding of bovine immune responses to pathogens, aiding vaccine development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize development with the specified tag.
Synonyms
SELL; L-selectin; CD62 antigen-like family member L; Leukocyte adhesion molecule 1; LAM-1; Leukocyte-endothelial cell adhesion molecule 1; LECAM1; Lymph node homing receptor; CD antigen CD62L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-370
Protein Length
Full Length of Mature Protein
Species
Bos taurus (Bovine)
Target Names
Target Protein Sequence
WTYHYSKRPMPWEKARAFCRENYTDLVAIQNKGEIEYLNKTLPFSRTYYWIGIRKVEGVWTWVGTNKSLTEEAKNWGAGEPNNRKSKEDCVEIYIKRNKDSGKWNDDACHKAKTALCYTASCKPWSCSGHGQCVEVINNYTCNCDLGYYGPECQFVTQCVPLEAPKLGTMACTHPLGNFSFMSQCAFNCSKGTDMIGVEETTCAPFGNWSSPEPTCRVIQCEPLTEPDLGTMDCNHPLVDFGFSSTCTFSCSEEAELTGEKKTICGLSGNWSSPSPRCQKINRTISINEESDYNPLFIPVAVMVTAFSGLAFIIWLARRLKRKSKKVSEKHG
Uniprot No.

Target Background

Function
Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. It facilitates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. L-selectin promotes initial tethering and rolling of leukocytes in endothelia.
Gene References Into Functions
  1. Five single nucleotide polymorphisms (SNPs) from different exons in selectin SELP, two in selectin SELL and one in selectin SELE were genotyped in 337 Holstein Friesian heifers using PCR-RFLP. PMID: 28419109
  2. gammadelta T cells, the primary recirculating subset in both afferent and efferent lymph, exhibit high levels of CD62L cell surface expression. PMID: 22156593
  3. This research demonstrates the existence of central memory T cells (Tcm) in cattle and suggests that CD62L may serve as a marker for monitoring Tcm in infections and vaccine development studies in ruminants. PMID: 19766669
  4. The study determined the effects of Mycobacterium-induced proliferation and apoptosis on CD25, CD44, and CD62L expression on peripheral blood T-cell subsets from M. bovis-infected cattle. PMID: 12496181
  5. Intramammarily administered lipopolysaccharides appear to play a significant role in modulating L-selectin and beta2 integrin expression on circulating bovine polymorphonuclear leukocytes. PMID: 12906050
  6. The findings indicate that glucocorticoid-induced suppression of L-selectin is likely mediated by direct effects of glucocorticoid receptor activation on intracellular reservoirs of L-selectin mRNA and protein, predominantly in blood neutrophils. PMID: 14761937

Show More

Hide All

Database Links

KEGG: bta:281485

STRING: 9913.ENSBTAP00000044113

UniGene: Bt.2314

Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Highly expressed in lymphocytes from peripheral lymph nodes. Low in lymphocytes isolated from Peyer patches.

Q&A

What is bovine L-selectin and how does it compare to human and murine homologs?

Bovine L-selectin (SELL/CD62L) is an adhesion molecule belonging to the selectin family of proteins. Like its human and murine counterparts, it consists of a large, highly glycosylated extracellular domain, a single transmembrane domain, and a small cytoplasmic tail . It functions as a "homing receptor" for leukocytes, enabling their entry into secondary lymphoid tissues via high endothelial venules. The protein mediates the initial tethering and rolling stages of leukocyte recruitment during inflammation .

While the fundamental structure and function are conserved across species, species-specific differences in glycosylation patterns and binding affinities may exist. Researchers should note that antibodies and reagents developed against human or murine L-selectin may have variable cross-reactivity with bovine L-selectin, necessitating validation experiments when transitioning between species models .

What cellular processes does bovine L-selectin regulate in the immune system?

Bovine L-selectin regulates multiple critical immune processes:

  • Lymphocyte recirculation between blood and lymphoid tissues, maintaining appropriate tissue distribution of lymphocyte subpopulations

  • Leukocyte tethering and rolling on activated endothelium during inflammation

  • Transendothelial migration (TEM) of leukocytes, particularly neutrophils

  • Induction of lymphocyte homeostatic proliferation during lymphopenia

  • Signaling functions during leukocyte migration that coordinate with other adhesion molecules

Recent research has demonstrated that L-selectin has roles beyond the initial tethering and rolling stages, including co-clustering with PECAM-1 during transendothelial migration, which potentiates L-selectin shedding and expedites migration times .

What are the key structural features of recombinant bovine L-selectin proteins?

Recombinant bovine L-selectin proteins typically include:

  • A lectin-like domain responsible for carbohydrate binding

  • An epidermal growth factor (EGF)-like domain

  • Short consensus repeat (SCR) domains similar to those in C3/C4 binding proteins

  • A fusion tag (often His-tag) for purification and detection purposes

  • The protein sequence corresponding to the extracellular domain (often Met 1-Asn 332 or similar, based on homology with mouse and human proteins)

When expressed in mammalian systems like HEK293 cells, recombinant bovine L-selectin undergoes post-translational modifications, including glycosylation, that are critical for proper folding and function. The molecular weight on SDS-PAGE typically appears higher (approximately 40-57 kDa) than the calculated mass due to glycosylation .

How can recombinant bovine L-selectin be used to study transendothelial migration mechanisms?

Recombinant bovine L-selectin can be utilized in several sophisticated experimental approaches to investigate transendothelial migration:

  • Co-clustering studies: Fluorescently labeled recombinant L-selectin can be used to visualize its spatial and temporal relationships with other adhesion molecules (like PECAM-1) during TEM. Techniques such as Förster Resonance Energy Transfer (FRET) can detect molecular interactions at nanometer scale resolutions .

  • Shear flow chamber assays: Parallel plate flow chambers coated with recombinant L-selectin ligands can help evaluate the dynamics of leukocyte adhesion under physiologically relevant shear stress conditions. This approach allows for real-time visualization of tethering, rolling, and firm adhesion events .

  • Time-to-transmigration (TTT) assays: Using endothelial monolayers on permeable supports, researchers can assess how blocking L-selectin function (with antibodies or recombinant proteins) affects the efficiency of neutrophil or lymphocyte transmigration. Recent findings indicate that L-selectin co-clusters with PECAM-1 during TEM, leading to enhanced L-selectin shedding and expedited transmigration times .

  • In vitro clustering experiments: Antibody-mediated clustering of L-selectin in the presence of other adhesion molecules can reveal "inside-out" signaling mechanisms that contribute to leukocyte migration .

What signaling pathways are activated upon L-selectin engagement, and how can they be studied in bovine systems?

L-selectin engagement activates multiple signaling cascades, including:

  • Akt family kinases

  • JNK family kinases

  • p38 MAPK-dependent pathways

  • Calcium flux and cytoskeletal reorganization

These pathways can be studied in bovine systems using:

  • Phospho-specific antibodies: To detect activation of specific kinases following L-selectin clustering or engagement with recombinant ligands.

  • Kinase inhibitors: Small molecule inhibitors can help delineate the contribution of specific pathways to L-selectin-mediated functions.

  • Live-cell imaging with calcium indicators: To monitor intracellular calcium fluxes following L-selectin engagement.

  • Recombinant L-selectin mutants: Engineered proteins with modifications in the cytoplasmic domain can help identify critical residues involved in signal transduction.

  • Proteomics approaches: Mass spectrometry analysis of immunoprecipitated L-selectin complexes can identify novel binding partners in the signaling cascade .

How does L-selectin shedding regulate immune cell function, and what techniques can quantify this process?

L-selectin shedding, mediated primarily by ADAM17 (a disintegrin and metalloproteinase), plays several regulatory roles:

  • Facilitates detachment from the endothelium during transmigration

  • Modulates the activation state of leukocytes

  • Controls tissue distribution of immune cells

  • Expedites transendothelial migration, particularly across TNF-activated but not IL-1β-activated endothelium

Techniques to quantify L-selectin shedding include:

  • Flow cytometry: Measures cell surface L-selectin levels before and after activation stimuli.

  • ELISA: Detects soluble L-selectin in culture supernatants or biological fluids.

  • Immunofluorescence microscopy: Visualizes L-selectin distribution during different stages of transmigration. This technique has revealed that neutrophils captured in mid-TEM retain L-selectin in both pseudopods and uropods .

  • Shedding inhibitors: Small molecule inhibitors like TAPI-0 can be used to block L-selectin shedding and assess functional consequences. Studies have shown that blocking L-selectin shedding results in significantly slower neutrophil transmigration times across TNF-activated endothelial monolayers .

What expression systems are optimal for producing functional recombinant bovine L-selectin?

The selection of an expression system for recombinant bovine L-selectin should consider several factors:

  • Mammalian expression systems (HEK293 cells): Provide proper folding and post-translational modifications, particularly glycosylation patterns that are critical for L-selectin function. This is the preferred system for studies requiring fully functional protein .

  • Insect cell systems (Sf9 Baculovirus): Offer a compromise between bacterial systems and mammalian cells, providing some post-translational modifications while yielding higher protein quantities. This system has been used successfully for producing human L-selectin .

  • E. coli systems: While less suitable for full-length L-selectin due to lack of glycosylation machinery, they may be useful for producing specific domains for structural studies.

Key methodological considerations include:

  • Incorporating a signal peptide for secretion

  • Including purification tags (typically His-tag at C-terminus)

  • Optimizing codon usage for the expression system

  • Implementing quality control measures to confirm proper folding and glycosylation

  • Validation of biological activity through binding assays

What purification strategies maximize yield and maintain functionality of recombinant bovine L-selectin?

Effective purification strategies include:

  • Immobilized metal affinity chromatography (IMAC): For His-tagged L-selectin proteins, typically the first purification step.

  • Size exclusion chromatography: Separates monomeric L-selectin from aggregates and other contaminants.

  • Ion exchange chromatography: Further purifies based on charge properties.

  • Affinity chromatography with L-selectin ligands: Can be used for activity-based purification.

Critical considerations for maintaining functionality:

  • Buffer composition: Include calcium ions (Ca²⁺) as L-selectin binding is divalent cation-dependent.

  • pH control: Maintain pH in the physiological range (7.2-7.4) throughout purification.

  • Protease inhibitors: Prevent degradation, particularly important as L-selectin is susceptible to proteolytic cleavage.

  • Glycerol or other stabilizers: Include in storage buffers to maintain protein stability.

  • Temperature control: Perform purification at 4°C when possible to minimize degradation .

How can researchers validate the structural integrity and biological activity of purified recombinant bovine L-selectin?

Comprehensive validation should include:

  • SDS-PAGE and Western blotting: Confirm molecular weight and immunoreactivity.

  • Mass spectrometry: Verify protein identity and assess glycosylation patterns.

  • Circular dichroism (CD) spectroscopy: Evaluate secondary structure elements.

  • Dynamic light scattering (DLS): Assess homogeneity and detect aggregation.

  • Functional binding assays: Using known L-selectin ligands such as:

    • GlyCAM-1

    • CD34

    • MAdCAM-1

    • PSGL-1

    • Sulfated glycans

  • Cell adhesion assays: Test the ability of immobilized recombinant L-selectin to support leukocyte tethering and rolling under physiological flow conditions.

  • Competition assays: Demonstrate specific inhibition of binding by antibodies or known L-selectin antagonists .

How does bovine L-selectin differ from human and mouse homologs in structure and function?

While L-selectin is highly conserved across mammalian species, several notable differences exist:

FeatureBovine L-selectinHuman L-selectinMouse L-selectin
Amino acid identityReference~70-80%~65-75%
Molecular weight34-57 kDa (glycosylated)34-57 kDa (glycosylated)34-57 kDa (glycosylated)
Glycosylation patternsSpecies-specificContains sialyl Lewis<sup>x</sup>Contains sialyl Lewis<sup>x</sup>
Shedding regulationADAM17-dependentADAM17-dependentADAM17-dependent
Signaling pathwaysLargely conservedWell-characterizedWell-characterized
Antibody cross-reactivityVariableReferenceVariable

Key functional considerations for researchers:

  • Binding affinity to various ligands may differ between species

  • Antibodies developed against human or mouse L-selectin may have limited cross-reactivity with bovine L-selectin

  • PSGL-1 co-clustering with L-selectin during neutrophil rolling occurs in mice but may not be conserved in humans or cattle

  • Signaling pathways downstream of L-selectin engagement are largely conserved but may have species-specific components

What experimental considerations are important when translating L-selectin research between bovine and other model systems?

When translating L-selectin research between species:

  • Antibody validation: Confirm cross-reactivity of anti-human or anti-mouse antibodies with bovine L-selectin before use.

  • Ligand specificity: Test binding specificity of bovine L-selectin to ligands characterized in other species.

  • Shedding dynamics: Validate that inhibitors of L-selectin shedding (e.g., TAPI-0) are effective in bovine systems.

  • Signaling pathway conservation: Confirm that signaling components identified in human or mouse systems are present and function similarly in bovine cells.

  • Functional assays: Adapt assay conditions (calcium concentrations, pH, ionic strength) to optimize for bovine proteins.

  • Consider agricultural relevance: Bovine-specific disease models may provide unique insights not available in murine models, particularly for conditions affecting cattle like bovine respiratory disease or mastitis .

What are common challenges in working with recombinant bovine L-selectin and how can they be addressed?

Researchers may encounter several challenges:

  • Protein aggregation:

    • Problem: L-selectin's highly glycosylated nature can lead to aggregation.

    • Solution: Optimize buffer composition with mild detergents or stabilizers; incorporate filtration steps; store at appropriate concentrations.

  • Inconsistent glycosylation:

    • Problem: Batch-to-batch variation in glycosylation patterns.

    • Solution: Standardize cell culture conditions; consider using glycosylation inhibitors for more homogeneous preparations when glycosylation isn't critical for the application.

  • Proteolytic degradation:

    • Problem: L-selectin is susceptible to proteolytic cleavage.

    • Solution: Include protease inhibitors during purification; avoid freeze-thaw cycles; store in single-use aliquots.

  • Poor binding activity:

    • Problem: Recombinant protein shows low biological activity.

    • Solution: Ensure calcium is present in binding buffers; verify structural integrity; check for proper folding and glycosylation .

How can researchers accurately quantify L-selectin-dependent adhesion and signaling in experimental systems?

Accurate quantification requires multiple complementary approaches:

  • Flow-based adhesion assays:

    • Parallel plate flow chambers with controlled shear stress

    • Video microscopy to capture rolling velocity, tethering frequency, and arrest

    • Analysis software to track individual cells over time

  • Signaling quantification:

    • Phospho-specific Western blotting with densitometry

    • Flow cytometry for phospho-proteins

    • FRET-based biosensors for real-time signaling

    • Calcium flux assays with ratiometric dyes

  • L-selectin clustering:

    • FRET/FLIM (Fluorescence Lifetime Imaging Microscopy) to measure molecular proximity

    • Super-resolution microscopy to visualize nanoscale distribution

    • Co-immunoprecipitation followed by Western blotting

  • Transmigration quantification:

    • Time-to-transmigration (TTT) assays

    • Transwell systems with fluorescent labeling

    • Live cell imaging of 3D matrix models

What controls are essential for interpreting experiments using recombinant bovine L-selectin?

Essential controls include:

  • Positive controls:

    • Known L-selectin ligands (GlyCAM-1, CD34)

    • Calcium-dependent binding (binding should be present with Ca²⁺ and absent with EDTA)

    • Human or mouse L-selectin with established activity profiles

  • Negative controls:

    • Heat-inactivated recombinant L-selectin

    • Blocking antibodies against L-selectin or its ligands

    • Competing soluble ligands or carbohydrates

    • Isotype control antibodies

  • Specificity controls:

    • L-selectin knockout cells or tissues (if available)

    • Cells treated with L-selectin sheddase (ADAM17) to remove endogenous L-selectin

    • Competitive inhibition with established L-selectin antagonists

  • Technical controls:

    • Background binding to untreated surfaces

    • Vehicle controls for inhibitors or activators

    • Unstained/unstimulated cells for flow cytometry

How might recombinant bovine L-selectin be used to develop therapeutics for inflammatory conditions in cattle?

Recombinant bovine L-selectin offers several promising therapeutic applications:

  • Antagonist development:

    • Soluble recombinant L-selectin could act as a competitive inhibitor by binding to endothelial ligands

    • Structure-based design of small molecule inhibitors targeting the lectin domain

    • Antibodies that block L-selectin-ligand interactions without inducing signaling

  • Anti-inflammatory strategies:

    • Targeted inhibition of L-selectin shedding could modify leukocyte trafficking

    • Dual-targeting approaches combining L-selectin and PECAM-1 inhibition

    • Nanoparticle delivery of L-selectin antagonists to sites of inflammation

  • Veterinary applications:

    • Development of treatments for bovine respiratory disease complex

    • Novel approaches to mastitis management

    • Potential therapies for bovine-specific inflammatory conditions

  • Diagnostic tools:

    • L-selectin shedding as a biomarker for inflammatory conditions

    • Imaging agents targeting activated endothelium expressing L-selectin ligands

What emerging technologies could enhance our understanding of L-selectin biology in bovine systems?

Several cutting-edge technologies hold promise:

  • Single-cell technologies:

    • Single-cell RNA sequencing to identify cell populations with unique L-selectin expression patterns

    • Mass cytometry (CyTOF) to correlate L-selectin with dozens of other markers

    • Single-cell proteomics to map L-selectin signaling networks

  • Advanced imaging:

    • Intravital microscopy to visualize L-selectin dynamics in living tissues

    • Super-resolution microscopy to resolve L-selectin clustering at nanoscale

    • Light sheet microscopy for 3D visualization of L-selectin in tissue contexts

  • Genome editing:

    • CRISPR/Cas9 modification of bovine cells to create L-selectin variants

    • Creation of reporter systems to monitor L-selectin expression and shedding

    • Engineering of primary bovine cells with fluorescently tagged endogenous L-selectin

  • Organ-on-chip technologies:

    • Microfluidic devices incorporating bovine endothelial cells

    • Biomimetic flow systems to model specific vascular beds

    • 3D printed tissue models incorporating multiple cell types

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.